معلومة

ب 5. إنزيمات الهيدروجين (وليس نازعات الهيدروجين) - علم الأحياء


يحتاج عالمنا بشدة إلى طريقة موفرة للطاقة لإنتاج H2 لإنتاج الطاقة دون إنتاج ملوثات نفايات. ألن يكون من الرائع استخدام مادة متفاعلة مثل الماء لإنتاج H2 (بدون استخدام التحليل الكهربائي) أو محفزات معدنية باهظة الثمن؟ قد تظهر الطبيعة الطريق. Coli الموجودة في نظام GI الخاص بنا) يمكن أن تستخدم معادن بسيطة مثل الحديد لإنتاج H2 من H + مع الإلكترونات لتقليل H + القادمة من متبرع (مثل الهيم المنخفض في البروتينات):

دوكس + H2

يمكن عكس التفاعل أيضًا في وجود متقبل للإلكترونات من H2 حيث يتأكسد:

Aox + H2 <=> Ared + H +

الإنزيمات التي تحفز إنتاج الهيدروجين هي إنزيمات الهيدروجين (وليس نازعات الهيدروجين). لاحظ أن اسم hydrogenases يعكس بشكل أفضل التفاعل العكسي عندما يتم تقليل جزيء (P) في حالة مؤكسدة (إلى S) ويتأكسد H2 إلى H +.

تظهر الهياكل البلورية للهيدروجينيز أنها فريدة من نوعها بين الإنزيمات المحتوية على المعادن. تحتوي على معدنين مرتبطين ببعضهما البعض. يمكن أن تكون المراكز المعدنية إما من الحديد أو من الحديد والنيكل. الروابط المتفاعلة مع المعادن هي نوعان من السموم الأيضية الكلاسيكية ، أول أكسيد الكربون والسيانيد. ممرات تدفق الإلكترونات و H2 تربط المعادن المدفونة والإنزيمات المتبقية. ترتبط المعادن أيضًا بمجموعات السلفهيدريل من السلاسل الجانبية للسيستين. يبدو أن إلكترونين يضافان إلى بروتون واحد مما يجعل أنيون هيدريد يقبل البروتون ليشكل H2. في هيدروجيني Fe ، تشوه هندسة الروابط المنسقة الرابطة بين مركزي الحديد ، مما يؤدي إلى مكواة ذات أرقام أكسدة مختلفة. يبدو أن الإلكترونات تتدفق من مركز إلى آخر ، كما يفعل أول أكسيد الكربون أيضًا. في نهاية المطاف ، يمكن طلاء الهيدروجين أو المحاكاة غير العضوية الصغيرة للموقع النشط على أقطاب كهربائية واستخدامها لعامة H2 عند وضعها في الماء في تجارب التحليل الكهربائي.


إنزيمات تكنولوجيا الطاقة

رودني بيرتون. ستيفن دبليو راجسدال ، طرق في علم الإنزيمات ، 2018

3.4 تنقية م CODH / ACS

تشكل إنزيمات CODH و ACS معقدًا محكمًا وملفوفًا طوال عملية التنقية. وبالتالي ، يتم تحديد كسور CODH / ACS باستخدام مقايسة نشاط أكسدة ثاني أكسيد الكربون والمواد الهلامية SDS-PAGE. في مثال مبكر لهذا المستحضر ، تمت متابعة المعالجة الحرارية عند 67 درجة مئوية لمدة 30 دقيقة عند حدوث خلل في الخلية بترسيب تدريجي لكبريتات الأمونيوم ، وتم إذابة أجزاء CODH في محلول عازلة 7.6 Tris - HCl مع 2 مم ديثيونيت الصوديوم (راجسدال ، كلارك وآخرون ، 1983). في هذا البروتوكول ، تضمنت خطوات التنقية الكروماتوغرافية راتنج السليلوز DE32 ، وراتنج الهيدروكسيلاباتيت ، واستبعاد الحجم ، و DEAE-Sephacel ، على التوالي.

في الوقت الحاضر في مختبرنا ، يتم تنقية CODH / ACS بواسطة FPLC. يضاف إلى كل غرام من الخلايا الجافة 4 مل من المخزن المؤقت للتحلل الذي يتكون من المخزن المؤقت أجبل (50 مم تريس - حمض الهيدروكلوريك pH 7.6 مع 2 مم ديثيونيت الصوديوم و 2 مم DTT) ، 0.5 مم PMSF ، 0.25 مجم / مل من الليزوزيم ، و 10 ميكروغرام / مل DNase I (روش: الدرجة الثانية ، من بنكرياس البقر). للحصول على 200 مل من المحللة ، يتم إجراء صوتنة عند 4 درجات مئوية ، وتشغيل 10 ثوانٍ "تشغيل" و 20 ثانية "إيقاف" لما مجموعه 15 دقيقة. يتم طرد المحللة عند 30000 دورة في الدقيقة لمدة ساعة واحدة عند 4 درجات مئوية. يتم بعد ذلك وضع المادة الطافية على 60 مل من راتنج Q-Sepharose سريع التدفق (GE Healthcare) والذي تمت معايرته في المخزن المؤقت Aجبل، والذي تم تطويره بتدرج ملح من 0 إلى 0.6 م كلوريد الصوديوم ، مع استخلاص CODH / ACS في كسور تحتوي على 0.3-0.4 م كلوريد الصوديوم.

الخطوة التالية هي الكروماتوغرافيا الكارهة للماء. يتم تجميع كسور CODH / ACS وتضاف كبريتات الأمونيوم إلى تركيز نهائي قدره 0.6 م. ثم يتم تطبيق المحلول على عمود يحتوي على 30 مل من راتنج فينيل سيفروز 6 سريع التدفق (Sigma-Aldrich) متوازن بـ 0.6 م كبريتات الأمونيوم في المخزن أجبل، وتدرج متناقص في كبريتات الأمونيوم ، 0.6-0.0 م، يتم تطبيقه. مزيلات معقد CODH / ACS في كسور تحتوي على 0.2-0.0 م كبريتات الامونيوم. نقاء البروتين الذي تم الحكم عليه بواسطة SDS-PAGE أعلى من 95٪ ويتنوع نشاط أكسدة ثاني أكسيد الكربون بين 200 و 300 وحدة / مجم عند 25 درجة مئوية.


الاستجابة الخلوية لهيدروكسيباتيت و ® Bioglass في هندسة الأنسجة والطب التجديدي

السمية الخلوية

اللاكتات ديهيدروجينيز (LDH) هو إنزيم خلوي خلوي يتم إطلاقه عند تلف غشاء الخلية. تم استخدامه لتقييم تلف الخلايا الناتج عن التعرض لمواد الاختبار [16]. تم تحديد LDH المنطلق عندما كانت الضامة البشرية على اتصال مع الجسيمات النانوية ، وهي علامة تشير إلى تلف غشاء الخلية ، كمقياس للسمية الخلوية للجسيمات النانوية.

تم تصنيع NanoHA و nanoCHA بمحتوى كربونات بنسبة 1٪ و 2.5٪ (CHA1 و CHA2) ، على التوالي ، بناءً على تفاعل ترسيب بين هيدروكسيد الكالسيوم (Ca (OH) 2) وحمض الفوسفوريك (H).3ص4) (كلاهما من الدرجة AnalaR ، BDH ، المملكة المتحدة). تم تحقيق استبدال الكربونات بإذابة ثاني أكسيد الكربون2 في المحلول أثناء عملية التفاعل [17]. تم تقدير تركيز جزيئات nanoHA و nanoCHA في وسط الاستزراع باستخدام مقياس خلايا الدم تحت مجهر لايكا مع أداة التقاط الإطار بعد تلطيخ الجسيمات النانوية بوزن نترات الفضة بنسبة 1 ٪ لزيادة التباين.

تمت إضافة جسيمات NanoHA و nanoCHA بأعداد لا تقل عن مليون إلى 100 مليون جسيم إلى كل بئر اختبار يحتوي على 0.5 مليون خلية. بعد 24 ساعة من الاستنبات ، تم قياس إطلاق LDH من الخلايا (Cytotox 96 ، Promega ، Southampton ، المملكة المتحدة). تم استخدام البلاعم غير الملامسة للجسيمات كعنصر تحكم في الاختبار.

كما هو مبين في الشكل 15.2 ، كانت هناك زيادة كبيرة في إطلاق LDH من الضامة البشرية عندما كانت الخلايا على اتصال مع تركيز عالٍ من جزيئات nanoHA و nanoCHA (100 مليون جزيء) ، مما يشير إلى التأثيرات السامة للخلايا ، حيث يرتبط مقدار نشاط الإنزيم بـ مقدار تلف غشاء الخلية. لم يكن هناك فرق كبير بين nanoHA و nanoCHA. ومع ذلك ، انخفضت مستويات إطلاق LDH بشكل ملحوظ مع انخفاض تركيز الجسيمات النانوية من 100 مليون إلى 10 مليون و 1 مليون. لم يتم العثور على فرق كبير في إطلاق LDH بين 10 ملايين و 1 مليون جسيم مع اختبار التحكم (بدون جزيئات).

15.2. إطلاق LDH من البلاعم البشرية عند ملامستها لجزيئات nanoHA و nanoCHA1 و nanoCHA2 بتركيز يتراوح من 1 إلى 100 مليون جسيم لكل اختبار.


أبو جودة A ، Chippaux M & amp Pascal M-C (1979a) تقليل الفورمات-النتريت فيالإشريكية القولونية K12: دراسة فسيولوجية للنظام. يورو. J. Biochem. 95: 309-314

أبو جودة أ ، باسكال إم سي ، أمبير تشيبوكس إم (1979 ب) تقليل فورمات النتريت فيالإشريكية القولونية K12: تحديد المكونات المتضمنة في نقل الإلكترون. يورو. J. Biochem. 95: 315 - 321

Ackrell BAC و Asato RN و amp Mower HF (1966) أشكال متعددة من الهيدروجين البكتيرية. J. باكتيريول. 92: 828-838

Adams MWW & amp Hall DO (1979) تنقية هيدروجينيز الغشاء المرتبط بغشاءالإشريكية القولونية. بيوتشيم. ج. 183: 11-22

Albracht SPJ، Graf E-G & amp Thauer RK (1982) خصائص EPR للنيكل في الهيدروجيناز منالميثانوبكتيريوم الحرارية. FEBS ليت. 140: 311-313

Anraku Y & amp Gennis RB (1987) سلاسل الجهاز التنفسي الهوائيةالإشريكية القولونية. اتجاهات Biochem. علوم. 12: 262-266

Axley MJ و Böck A & amp Stadtman TC (1991) الخصائص التحفيزية لـالإشريكية القولونية فورمات نازعة الهيدروجين متحولة حيث يحل الكبريت محل السيلينيوم. بروك. ناتل. أكاد. علوم. الولايات المتحدة الأمريكية 88: 8450-8454

Axley MJ & amp Grahame DA (1991) حركية فورمات ديهيدروجينيزالإشريكية القولونية فورمات هيدروجينلياز. J. بيول. تشيم. 266: 13731 - 13736

Axley MJ و Grahame DA & amp Stadtman TC (1990)الإشريكية القولونية فورمات هيدروجين لياز: تنقية وخصائص مكون نازعة هيدروجيناز فورمات المعتمد على السيلينيوم. J. بيول. تشيم. 265: 18213 - 18218

Azoulay E ، Giordano G ، Grillet L ، Rosset R & amp Haddock BA (1978) خصائصالإشريكية القولونية طفرات K-12 التي تكون حساسة للكلورات عندما تنمو بشكل هوائي. FEMS ميكروبيول. بادئة رسالة. 4: 235-240

Baker KP & amp Boxer DH (1991)CHLA موضعالإشريكية القولونية K12: تورط العامل المساعد في الموليبدينوم. مول. ميكروبيول. 5: 901-908

Ballantine SP & amp Boxer DH (1985) إنزيمات هيدروجينيز المحتوية على النيكل المستمدة من الزراعة اللاهوائيةالإشريكية القولونية K-12. J. باكتيريول. 163: 454-459

Ballantine SP & amp Boxer DH (1986) عزل وتوصيف جزء نشط قابل للذوبان من إنزيم الهيدروجينيز 2 من أغشية المزروعة اللاهوائيةالإشريكية القولونية. يورو. J. Biochem. 156: 277-284

Barrett EL ، Jackson CE ، Fukumoto HT & amp Chang GW (1979) فورمات نازعة الهيدروجين المسوخالسالمونيلا تيفيموريوم: وسيلة جديدة لعزلتهم وفئات متحولة جديدة. مول. الجنرال جينيه. 177: 95-101

Barrett EL & amp Riggs DL (1982)السالمونيلا تيفيموريوم المسوخات المعيبة في فورمات ديهيدروجينيز المرتبطة باختزال النترات. J. باكتيريول. 149: 554-560

Belaich A & amp Belaich JP (1976) دراسة قياس دقيق للنمو اللاهوائي لـالإشريكية القولونية: مخططات النمو الحراري في وسط اصطناعي. J. باكتيريول. 125: 14-18

Berg BL، Baron C & amp Stewart V (1991a) نترات هيدروجيناز فورمات المحفز بالنترات فيالإشريكية القولونية K-12: دليل على أن بنية حلقة جذعية mRNA ضرورية لفك تشفير أوبال (UGA) مثل سيلينوسيستين. J. بيول. تشيم. 266: 22386 - 22391

Berg BL ، Li J ، Heider J & amp Stewart V (1991b) نترات هيدروجيناز فورمات المحفز بالنترات فيالإشريكية القولونية K-12: تسلسل النوكليوتيدات لـfdnGHI مشغل ودليل على أن أوبال (UGA) يشفر سيلينوسيستين. J. بيول. تشيم. 266: 22380 - 22385

Berg BL & amp Stewart V (1990) الجينات الهيكلية لنزع هيدروجيناز فورمات المحفز بالنترات فيالإشريكية القولونية K-12. علم الوراثة 125: 691-702

Bernhard T & amp Gottschalk G (1978 أ) هيدروجينازالإشريكية القولونيةوتنقية بعض خصائص ووظيفة الانزيم. في: Schlegel HG & amp Schneider K (Eds) Hydrogenases: نشاطها التحفيزي وهيكلها ووظيفتها (ص 199-208). E. Goltze KG ، جوتنجن

Bernhard T & amp Gottschalk G (1978 ب) إنتاجية خلاياالإشريكية القولونية أثناء النمو اللاهوائي على الفومارات والهيدروجين الجزيئي. قوس. ميكروبيول. 116: 235 - 238

Bilous PT ، Cole ST ، Anderson WF & amp Weiner JH (1988) تسلسل النيوكليوتيدات منdmsabc أوبرون ترميز اختزال ثنائي ميثيل سلفوكسيد اللاهوائي لـالإشريكية القولونية. مول. ميكروبيول. 2: 785-795

Birkmann A & amp Böck A (1989) توصيف أرابطة الدول المستقلة عنصر الحمض النووي التنظيمي الضروري لتحريض فورمات جين نازعة الهيدروجين (fdhF) منالإشريكية القولونية. مول. ميكروبيول. 3: 187 - 195

Birkmann A، Hennecke H & amp Böck A (1989) إنشاء مناطق محفز خيالي عن طريق تبادل التسلسلات التنظيمية الأولية منfdhF ونيف الجينات. مول. ميكروبيول. 3: 697-703

Birkmann A و Sawers RG & amp Böck A (1987a)ntrA المنتج الجيني في التمثيل الغذائي اللاهوائيالإشريكية القولونية. مول. الجنرال جينيه. 210: 535-542

Birkmann A، Zioni F، Sawers G & amp Böck A (1987b) العوامل التي تؤثر على تنظيم النسخ لمسار فورمات-هيدروجين-لايزي منالإشريكية القولونية. قوس. ميكروبيول. 148: 44-51

Blasco F و Iobbi C و Giordano G و Chippaux M & amp Bonnefoy V (1989) اختزال نتراتالإشريكية القولونية: الانتهاء من تسلسل النوكليوتيدات مننار أوبرون وإعادة تقييم دور الوحدات الفرعية α و في ربط الحديد ونقل الإلكترون. مول. الجنرال جينيه. 218: 249-257

Böck A و Forchhammer K و Heider H & amp Baron C (1991a) تخليق بروتين السيلينوبر: توسع في الشفرة الجينية. اتجاهات Biochem. علوم. 16: 463-467

Böck A ، Forchhammer K ، Heider J ، Leinfelder W ، Sawers G ، Veprek B & amp Zinoni F (1991b) Selenocysteine: الحمض الأميني الحادي والعشرون. مول. ميكروبيول. 5: 515-520

Böhm R و Sauter M & amp Böck A (1990) تسلسل النوكليوتيدات والتعبير عن الأوبرا فيالإشريكية القولونية ترميز مكونات فورمات الهيدروجين. مول. ميكروبيول. 4: 231 - 243

Bokranz M ، Gutmann M ، Körtner C ، Kojro E ، Fahrenholz F ، Lauterbach F & amp Kröger A (1991) الاستنساخ وتسلسل النيوكليوتيدات للجينات الهيكلية التي تشفر فورمات ديهيدروجينيزWolinella succinogenes. قوس. ميكروبيول. 156: 119-128

Boone-Miller J و Scott DJ & amp Amy NK (1987) تنظيم نسخ حساس للموليبدينومCHLD موضعالإشريكية القولونية. J. باكتيريول. 169: 1853-1860

Bourne HR و Sanders DA & amp McCormick F (1991) عائلة GTPase الفائقة: البنية المحفوظة والآلية الجزيئية. Nature (لندن) 349: 117-127

Brown TA & amp Shrift A (1982) الاستيعاب الانتقائي للسيلانيت بواسطةالإشريكية القولونية. علبة. J. ميكروبيول. 28: 307 - 310

Chaudhuri A & amp Krasna AI (1987) عزل الجينات المطلوبة لتخليق إنزيم الهيدروجين فيالإشريكية القولونية. J. الجنرال ميكروبيول. 133: 3289 - 3298

Chiang RC ، Cavicchioli R & amp Gunsalus RP (1992) تحديد وتوصيفNarQ، مستشعر نترات ثان لتنظيم الجينات المعتمد على النترات فيالإشريكية القولونية. مول. ميكروبيول. 6: 1913-1923

Chippaux M و Pascal M-C & amp Casse F (1977) يشكلون نظام هيدروجينليز فيالسالمونيلا تيفيموريوم LT2. يورو. J. Biochem. 72: 149-155

Colbeau A و Magnin JP و Cauvin B و Champion T & amp Vignais PM (1993) تنظيم الجينات اللازمة لتعبير هيدروجينيز فيكبسولات رودوباكتر. تحليل التسلسل وتحديد اثنينhyp المسوخ التنظيمي. مول. ميكروبيول. 8: 15-29

Cole JA & amp Wimpenny JWT (1966) العلاقات المتداخلة بين السيتوكروم المحتمل منخفض الأكسدةج 552 والهيدروجينيز في اللاهوائية الاختيارية. بيوكيم. بيوفيز. اكتا 128: 419-425

Corcuera GL و Bastidas M & amp Dubourdieu M (1993) امتصاص الموليبدينوم فيالإشريكية القولونية ك 12. J. الجنرال ميكروبيول. 139: 1869-1875

Cotter PG & amp Gunsalus RP (1992) مساهمة منfnr وأرك منتجات الجينات بتنسيق تنظيم السيتوكروما ود أوكسيديز (cyoABCDE وسيداب) الجينات فيالإشريكية القولونية. FEMS ميكروبيول. بادئة رسالة. 91: 31-36

Cox JC، Edwards ES & amp DeMoss JA (1981) تحليل نازعات هيدروجين فورمات مميزة تحتوي على السيلينيوم منالإشريكية القولونية. J. باكتيريول. 145: 1317-1324

Darwin A، Hussain H، Griffiths L، Grove J، Sambongi Y، Busby S & amp Cole J (1993a) تنظيم وتسلسل الجين البنيوي للسيتوكرومج 552 من عندالإشريكية القولونية: ليس hexahaem ولكن 50 kDa tetrahaem nitrite reductase. مول. ميكروبيول. 9: 1255-1266

Darwin A، Tormay P، Page L، Griffiths L & amp Cole J (1993b)الإشريكية القولونية ك 12. J. الجنرال ميكروبيول. 139: 1829-1840

DeMoss JA & amp Hsu P-Y (1991)نارك يعزز امتصاص النترات وإفراز النتريت فيهالإشريكية القولونية. J. باكتيريول. 173: 3303 - 3310

Dross F و Geisler V و Lenger R و Theis F و Kraft T و Fahrenholz F و Kojro E و Duchene A و Tripier D و Juvenal K & amp Kröger A (1992)Wolinella succinogenes. يورو. J. Biochem. 206: 93-102

Ehrenreich A و Forchhammer K و Tormay P و Veprek B & amp Böck A (1992)بكتريا قولونية: تنقية وتوصيف الانزيم المحفز لتنشيط السيلينيوم. يورو. J. Biochem. 206: 767-773

Eidsness MK و Scott RA و Pickril B و DerVartanian DV و LeGall J و Moura I و Moura JJG & amp Peck HD (1989) دليل على تنسيق السيلينوسيستين مع نيكل الموقع النشط في هيدروجيناز (NiFeSe) منديسولفوفيبريو باكولاتوس. بروك. ناتل. أكاد. علوم. الولايات المتحدة 86: 147-151

Eitinger T & amp B Friedrich (1991) الاستنساخ وتسلسل النيوكليوتيدات والتعبير غير المتجانسة لجين نقل النيكل عالي التقارب منAlcaligenes eutrophus. J. بيول. تشيم. 266: 3222 - 3227

Enoch HG & amp Lester RL (1974) دور السيتوكروم الجديدب- تحتوي على اختزال النترات والكينون فيفي المختبر إعادة بناء نشاط اختزال فورمات نتراتبكتريا قولونية. بيوتشيم. بيوفيز. الدقة. كومون. 61: 1234-1241

Enoch HG & amp Lester RL (1975) تنقية وخصائص فورمات ديهيدروجينيز ونترات اختزال منالإشريكية القولونية. J. بيول. تشيم. 250: 6693-6705

Forchhammer K، Boesmiller K & amp Böck A (1991a) وظيفة سينسيز سيلينوسيستين و SELB في تخليق ودمج سيلينوسيستين. بيوكيمي 73: 1481-1486

Forchhammer K، Leinfelder W & amp Böck A (1989) تحديد عامل ترجمة جديد ضروري لإدماج السيلينوسيستين في البروتين. Nature (لندن) 342: 453-456

Forchhammer K، Leinfelder W، Boesmiller K، Veprek B & Böck A (1991b) Selenocysteine ​​synthase منالإشريكية القولونية: تسلسل النوكليوتيدات للجين (سيلا) وتنقية البروتين. J. بيول. تشيم. 266: 6318-6323

Francis K و Patel P و Wendt JC & amp Shanmugam KT (1990) تنقية وتوصيف شكلين من إنزيم الهيدروجينيز 1 منالإشريكية القولونية. J. باكتيريول. 172: 5750-5757

Freundlich M، Ramani N، Mathew E، Sirko A & amp Tsui P (1992) دور عامل مضيف التكامل في التعبير الجيني فيالإشريكية القولونية. مول. ميكروبيول. 6: 2557-2563

Friedrich B & amp Schwarz E (1993) البيولوجيا الجزيئية لاستخدام الهيدروجين في الكيميائيات الهوائية. Annu. القس ميكروبيول. 47: 351-383

Fujita T & amp Sato R (1967) تطور الغاز المعتمد على النتريت في الخلايا التي تحتوي على السيتوكرومج 552. J. Biochem. (طوكيو) 62: 230-238

Fukuyama T & amp Ordal EJ (1965) استحثاث التخليق الحيوي لهيدروجينلياز الفورميك في الخلايا التي تعاني من نقص الحديد فيالإشريكية القولونية. J. باكتيريول. 90: 673-680

Garland PB و Downie JA & amp Haddock BA (1975) إزفاء البروتون واختزال نترات الجهاز التنفسيالإشريكية القولونية. بيوتشيم. ج 152: 547-559

Gest H & amp Peck HD (1955) دراسة تفاعل الهيدروجين مع الأنظمة المشتقة من بكتيريا coliaerogenes الطبيعية واللاهوائية. J. باكتيريول. 70: 326 - 334

Giordano G ، Medani C-L ، Mandrand-Berthelot M-A & amp Boxer DH (1983) فورمات ديهيدروجينيز منالإشريكية القولونية. FEMS ميكروبيول. بادئة رسالة. 17: 171 - 177

Glick BR، Wang PY، Schneider H & amp Martin WG (1980) تحديد وتوصيف جزئيالإشريكية القولونية متحولة مع نشاط الهيدروجين المتغير. علبة. J. Biochem. 58: 361–367

Glick BR، Zeisler J، Banazuk AM، Friesen JD & amp Martin WG (1981) التحديد والتوصيف الجزئي للبلازميد الذي يحتوي على جين الهيدروجين المرتبط بالغشاء منبكتريا قولونية. الجين 15: 201-206

Graf E-G & amp Thauer RK (1981) Hydrogenase fromالميثانوبكتيريوم الحرارية: إنزيم يحتوي على النيكل. FEBS ليت. 136: 165–169

Graham A (1981) تنظيم إنزيم الهيدروجيناز في الغشاء السيتوبلازمي لـالإشريكية القولونية. بيوتشيم. جي 197: 283 - 291

Graham A & amp Boxer DH (1981) تنظيم فورمات ديهيدروجينيز في الغشاء السيتوبلازمي لـالإشريكية القولونية. بيوتشيم. ياء 195: 627-637

Graham A، Boxer DH، Haddock BA، Mandrand-Berthelot M-A & amp Jones RW (1980) التحليل المناعي للهيدروجين المرتبط بالغشاء لـالإشريكية القولونية. FEBS ليت. 113: 167 - 172

Green J ، Trageser M ، Six S ، Unden G & amp Guest JR (1991) توصيف بروتين FNR لـالإشريكية القولونية، منظم نسخ ملزم بالحديد. بروك. R. Soc. لندن 244: 137-144

Guest JR (1992) التعبير الجيني المنظم بالأكسجين فيالإشريكية القولونية. J. الجنرال ميكروبيول. 138: 2253 - 2263

Gunsalus RP (1992) التحكم في تدفق الإلكترون فيالإشريكية القولونية: النسخ المنسق لجينات المسار التنفسي. J. باكتيريول. 174: 7069–7074

Haddock BA & amp Jones CW (1977) التنفس البكتيري. باكتيريول. القس 41: 47-99

Haddock BA & amp Mandrand-Berthelot M-A (1982)الإشريكية القولونية سلسلة الجهاز التنفسي فورمات إلى نترات: التحليل الجيني. بيوتشيم. شركة عبر. 10: 478-480

Hallahan DL ، Fernandez VM & amp Hall DO (1987) تنشيط عكسي للهيدروجين منالإشريكية القولونية. يورو. J. Biochem. 165: 621-625

He S-H ، Teixeira M ، LeGall J ، Patil DS ، DerVartanian DV ، Huynh BH & amp Peck HD (1989) دراسات EPR مع 77 Se المخصب (NiFeSe) هيدروجيناز منديسولفوفيبريو باكولاتوس. دليل ليجند السيلينيوم على نيكل الموقع النشط. J. بيول. تشيم. 264: 2678-2682

Heider J & amp Böck A (1993) استقلاب السيلينيوم في الكائنات الحية الدقيقة. حال. الفيزيول الميكروبي. 35: 71-109

Higgins CF ، Gallacher MP ، Hyde SC ، Mimmack ML & amp Pearce SR (1990) أنظمة النقل المعتمدة على البروتين المرتبط بالبروتين: المكونات المرتبطة بالغشاء. فيل. عبر. R. Soc. لندن 326: 353–365

Hopper S ، Babst M ، Schlensog V ، Fischer H-M ، Hennecke H & amp Böck A (1994) تعبير منظمفي المختبر من الجينات لترميز مكونات فورمات هيدروجينالإشريكية القولونية. J. بيول. تشيم. في الصحافة

Itagaki E ، Fujita T & amp Sato R (1961) السيتوكرومب 1- تفاعل اختزال النترات في نظام مذاب منالإشريكية القولونية. بيوكيم. بيوفيز. اكتا 51: 390-392

Itagaki E و Fujita T & amp Sato R (1962) الذوبان وخصائص فورمات ديهيدروجينيز والسيتوكرومب 1 من عندالإشريكية القولونية. J. Biochem. (طوكيو) ٥٢: ١٣١ - ١٤١

Iuchi S & amp Lin ECC (1987)نارل ينشط منتج الجين أوبرا اختزال النترات ويقمع اختزال فومارات وتريميثيل أمينن- أوبراكسيد اختزال فيالإشريكية القولونية. بروك. ناتل. أكاد. علوم. الولايات المتحدة الأمريكية 84: 3901-3905

Iuchi S & amp Lin ECC (1991) تكييفالإشريكية القولونية لظروف الجهاز التنفسي: تنظيم التعبير الجيني. الخلية 66: 5-7

Iuchi S & amp Lin ECC (1993) تكييفالإشريكية القولونية لبيئات الأكسدة والاختزال عن طريق التعبير الجيني. مول. ميكروبيول. 9: 9-15

Jacobi A ، Rossmann R & amp Böck A (1992)hyp المنتجات الجينية أوبرون مطلوبة لنضج إنزيمات الهيدروجيناز النشط تحفيزيًا فيالإشريكية القولونية. قوس. ميكروبيول. 158: 444-451

Jamieson DJ ، Sawers RG ، Rugman PA ، Boxer DH & amp Higgins CF (1986) تأثيرات الطفرات التنظيمية اللاهوائية وقمع الهدم على تنظيم استقلاب الهيدروجين وتكوين إنزيم الهيدروجيناز فيالسالمونيلا تيفيموريوم. J. باكتيريول. 168: 405-411

Jasper P & amp Silver S (1977) نقل المغنيسيوم في الكائنات الحية الدقيقة ، في: Weinberg ED (Ed) الكائنات الدقيقة والمعادن (الصفحات 7-74). مارسيل ديكر ، نيويورك

Johann S & amp Hinton SM (1987) تسلسل الاستنساخ والنيوكليوتيدات لـCHLD المكان. J. باكتيريول. 169: 1911-1916

Johnson JL، Bastian NR & amp Rajagopalan KV (1990) الموليبدينوم جوانين ثنائي النوكليوتيد: شكل معدل من موليبدوبترين تم تحديده في الموليبدينوم العامل المساعد لاختزال ثنائي ميثيل سلفوكسيد منرودوباكتر سبيرويدس فورما التخصصنيتريفيكان. بروك. ناتل. أكاد. علوم. الولايات المتحدة الأمريكية 87: 3190-3194

جونسون JL ، Indermaur LW & amp Rajagopalan KV (1991) التخليق الحيوي للعامل المساعد للموليبدينوم فيالإشريكية القولونية. J. بيول. تشيم. 266: 12140-12145

Jones RW (1980a) انتقال البروتون عن طريق نازعة هيدروجين فورمات مرتبطة بالغشاءالإشريكية القولونية. FEMS ميكروبيول. بادئة رسالة. 8: 167 - 171

Jones RW (1980b) دور الهيدروجينيز المرتبط بالغشاء في أكسدة الهيدروجين الجزيئي التي تحفظ الطاقة بواسطةالإشريكية القولونية. بيوتشيم. ي. ١٨٨: ٣٤٥ - ٣٥٠

Jones RW & amp Garland PB (1977) مواقع وخصوصية تفاعل مركبات البيبيريديليوم مع الإنزيمات التنفسية اللاهوائية لـالإشريكية القولونية: آثار حواجز النفاذية التي يفرضها الغشاء السيتوبلازمي. بيوتشيم. ي. 164: 199-211

Jones RW، Lamont A & amp Garland PB (1980) آلية إزاحة البروتون مدفوعة بمركب اختزال نترات الجهاز التنفسي لـالإشريكية القولونية. بيوتشيم. 190: 79-94

كالمان L & amp Gunsalus RP (1988)frdR جينالإشريكية القولونية ينظم عالميًا العديد من العوامل التي تشارك في النمو اللاهوائي استجابةً للنترات. J. باكتيريول. 170: 623-629

Karube I و Tomiyama M & amp Kikuchi A (1984) الاستنساخ الجزيئي ورسم الخرائط الماديةهيدرو جينالإشريكية القولونية K-12. FEMS ميكروبيول. بادئة رسالة. 25: 165–168

Kessler D و Herth W & amp Knappe J (1992) البنية التحتية وخاصية التبريد البيروفاتفورماتي- لياز لبروتين AdhE متعدد الإنزيم لـالإشريكية القولونية. J. بيول. تشيم. 267: 18073-18079

Knappe J ، Neugebauer FA ، Blaschkowski HP & amp Gänzler M (1984) يقدم التنشيط اللاحق للترجمة الجذور الحرة إلى البيروفات فورمات لياز. بروك. ناتل. أكاد. علوم. الولايات المتحدة الأمريكية 81: 1332-1335

Knappe J & amp Sawers G (1990) طريق كيميائي جذري إلى acetyl-CoA: نظام البيروفات فورمات-لياز المستحث اللاهوائيالإشريكية القولونية. FEMS ميكروبيول. القس 75: 383-398

Kohara Y ، Akiyama K & amp Isono K (1987) الخريطة المادية للكلبكتريا قولونية كروموسوم: تطبيق إستراتيجية جديدة للتحليل السريع والفرز لمكتبة جينومية كبيرة. الخلية 50: 495-508

Kramer GF & amp Ames BN (1988) عزل وتوصيف متحولة استقلاب السيلينيوم لـالسالمونيلا تيفيموريوم. J. باكتيريول. 170: 736-743

منظمة العفو الدولية كراسنا (1984) المسوخالإشريكية القولونية مع نشاط الهيدروجين المتغير. J. الجنرال ميكروبيول. 130: 779-787

Lambden PR & amp Guest JR (1976) Mutants ofالإشريكية القولونية K-12 غير قادر على استخدام فومارات كمستقبل إلكترون لاهوائي. J. الجنرال ميكروبيول. 97: 145-160

Lee JH، Patel P، Sankar P & amp Shanmugam KT (1985) عزل وتوصيف السلالات المتحولة منالإشريكية القولونية تغيرت في استقلاب الهيدروجين. J. باكتيريول. 162: 344–352

Lee JH و Wendt JC & amp Shanmugam KT (1990) تحديد الجين الجديد ،مولر، ضروري لاستخدام الموليبدات من قبلالإشريكية القولونية. J. باكتيريول. 172: 2079-2087

Leinfelder W ، Forchhammer K ، Veprek B ، Zehelein E & amp Böck A (1990)في المختبر توليف selenocysteinyl-tRNA ش كاليفورنيا من seryl-tRNA ش كاليفورنيا: مشاركة وتوصيفselD منتج الجينات. بروك. ناتل. أكاد. علوم. الولايات المتحدة الأمريكية 87: 543-547

Leinfelder W ، Forchhammer K ، Zinoni F ، Sawers G ، Mandrand-Bertheolt M-A & amp Böck A (1988a)الإشريكية القولونية الجينات التي تشارك منتجاتها في استقلاب السيلينيوم. J. باكتيريول. 170: 540-546

Leinfelder W و Zehelein E و Mandrand-Berthelot M-A & amp Böck A (1988b) جين لأنواع الحمض النووي الريبي الجديد التي تقبل L-serine وإدراج cotranslationally selenocysteine. نيتشر (لندن) 331: 723-725

Lester RL & amp DeMoss JA (1971) تأثيرات الموليبدات والسيلينيت على استقلاب الفورمات والنترات فيالإشريكية القولونية. J. باكتيريول. 105: 1006-1014

Li J & amp Stewart V (1992) توطين عناصر تسلسل المنبع المطلوبة للنترات والحث اللاهوائيfdn (فورمات ديهيدروجينيز- N) تعبير أوبرون فيالإشريكية القولونية K-12. J. باكتيريول. 174: 4935-4942

Lutz S ، Böhm R ، Beier A & amp Böck A (1990) توصيف المحفزات المتباينة المعتمدة على NtrA في الترميز العنقودي الجيني المعبر عنه اللاهوائي لمكونات hydrogenase 3 منالإشريكية القولونية. مول. ميكروبيول. 4: 13-20

Lutz S ، Jacobi A ، Schlensog V ، Böhm R ، Sawers G & amp Böck A (1991) التوصيف الجزيئي للأوبرا (hyp) ضروري لنشاط إنزيمات الهيدروجينيز الثلاثة فيالإشريكية القولونية. مول. ميكروبيول. 5: 123-135

Macy J ، Kulla H & amp Gottschalk G (1976) النمو اللاهوائي المعتمد على الهيدروجينالإشريكية القولونية على مالات: تشكيل السكسينات. J. باكتيريول. 125: 423-428

Maier T و Jacobi A و Sauter M & amp Böck A (1993) منتجhypB الجين ، المطلوب لإدماج النيكل في هيدروجيناز ، هو بروتين رابط جديد للنيوكليوتيدات في الجوانين. J. باكتيريول. 175: 630 - 635

Mandrand-Berthelot M-A و Couchoux-Luthaud G و Santini C-L & amp Giordano G (1988) Mutants ofالإشريكية القولونية معيب على وجه التحديد في نشاط نازعة هيدروجين فورمات الجهاز التنفسي. J. الجنرال ميكروبيول. 134: 3129 - 3139

Mandrand-Berthelot MA، Wee MKK & amp Haddock BA (1978) طريقة محسنة لتحديد وتوصيف طفراتالإشريكية القولونية قاصرة في نشاط فورمات ديهيدروجينيز. FEMS ميكروبيول. بادئة رسالة. 4: 37-40

Maupin JA & amp Shanmugam KT (1990) التنظيم الجيني لفورمات هيدروجينليازالإشريكية القولونية: دورfhlA منتج الجين كمنشط نسخي لجين تنظيمي جديد ،fhlB. J. باكتيريول. 172: 4798-4806

مينون إن كيه ، روبينز جيه ، بيك إتش دي ، شاتيلوس سي واي ، تشوي إي إس وأمبير برزيبيلا إيه إي (1990) استنساخ وتسلسل مفترضالإشريكية القولونية (NiFe) مشغل هيدروجينيز -1 يحتوي على ستة إطارات قراءة مفتوحة. J. باكتيريول. 172: 1969-1977

Menon NK و Robbins J و Wendt JC و Shanmugam KT & amp Przybyla AE (1991) تحليل الطفرات وتوصيفالإشريكية القولونية هييا أوبرون ، الذي يشفر (NiFe) هيدروجينيز I. J. Bacteriol. 173: 4851–4861

Miller JB & amp Amy NK (1983) عامل الموليبدينوم المساعد في طفرات الإدراج المقاومة للكلورات ونقص اختزال النترات فيالإشريكية القولونية. J. باكتيريول. 155: 793-801

Morpeth FF & amp Boxer DH (1985) التحليل الحركي لاختزال نترات الجهاز التنفسي منالإشريكية القولونية K-12. الكيمياء الحيوية 24: 40-46

Motteram PAS، McCarthy JEG، Ferguson SJ، Jackson JB & amp Cole JA (1981) الحفاظ على الطاقة أثناء تقليل النتريت المعتمد على الفورمات بواسطةالإشريكية القولونية. FEMS ميكروبيول. بادئة رسالة. 12: 317-320

ناجي بل ، ماكوركل GM & amp Zalkin H (1993)بورو، مصدر فورمات لبورت- الفوسفوريبوزيل المعتمد-ن- تخليق الفورميل جلايسيناميد. J. باكتيريول. 175: 7066-7073

Navarro C و Wu LF & amp Mandrand-Berthelot M-A (1993)نيك مشغلالإشريكية القولونية يشفر نظام نقل للنيكل يعتمد على البروتين المرتبط بالبيبلسميك. مول. ميكروبيول. 9: 1181-1191

Newman BM & amp Cole JA (1978) الموقع الكروموسومي والتأثيرات متعددة الاتجاهات للطفرات فينيرا + جينالإشريكية القولونية K12: الدور الأساسي لـنيرا + في اختزال النتريت وفي تفاعلات الأكسدة والاختزال اللاهوائية الأخرى. J. الجنرال ميكروبيول. 106: 1-12

Noji S و Nohno T و Saito T & amp Taniguchi S (1989)نارك المنتج الجيني يشارك في نقل النترات المستحث فيالإشريكية القولونية خلايا تتنفس النترات. FEBS ليت. 252: 139-143

Ordal EJ & amp Halvorson HO (1939) مقارنة بين إنتاج الهيدروجين من السكريات وحمض الفورميك بواسطة السلالات العادية والمتغيرة منالإشريكية القولونية. J. باكتيريول. 38: 199-220

Page L، Griffiths L & amp Cole JA (1990) أدوار فسيولوجية مختلفة لمسارين مستقلين لخفض النتريت إلى الأمونيا بواسطة البكتيريا القاتلة. قوس. ميكروبيول. 154: 249–354

Parkinson JS & amp Kofoid EC (1992) وحدات الاتصال في بروتينات الإشارات البكتيرية. Annu. القس جينيه. 26: 71 - 112

Pascal M-C و Casse F و Chippaux M & amp Lepelletier M (1975) التحليل الجيني للطفراتالإشريكية القولونية K12 والسالمونيلا تيفيموريوم نقص LT2 في نشاط الهيدروجين. مول. الجنرال جينيه. 141: 173 - 179

Paveglio MT ، Tang JS ، Unger RE & amp Barrett EL (1988) تنسيق تنفس التنفس فيالسالمونيلا تيفيموريوم: دراسات لاثنينrha-مرتبطfdn الجينات. J. باكتيريول. 170: 213-217

Pecher A و Zinoni F & amp Böck A (1985) إن seleno-polypeptide لنزعة الهيدروجين فورميك (مرتبط فورمات هيدروجين لياز) منالإشريكية القولونية: التحليل الجيني. قوس. ميكروبيول. 141: 359-363

Pecher A، Zinoni F، Jatsatienr C، Wirth R، Hennecke H & amp Böck A (1983) حول التحكم في الأكسدة والاختزال لتخليق الإنزيمات المستحثة اللاهوائية في المعوية. قوس. ميكروبيول. 136: 131-136

Peck HD & amp Gest H (1957) نازعة الهيدروجين الفورمي ومركب إنزيم الهيدروجين في بكتيريا coli-aerogenes. J. باكتيريول. 73: 706-721

Pinsent J (1954) الحاجة إلى السيلينيت والموليبدات في تكوين نازعة الهيدروجين فورميك بواسطة أعضاء مجموعة بكتيريا coli-aerogenes. بيوتشيم. ياء 57: 10-16

Pinsky MJ & amp Stokes JL (1952) متطلبات تكيف هيدروجينلياز فورميك في المعلقات غير المتكاثرة لـالإشريكية القولونية. J. باكتيريول. 64: 151 - 161

Plunkett G ، Burland V ، Daniels DL & amp Blattner FR (1993) تحليلالإشريكية القولونية الجينوم. ثالثا. تسلسل الحمض النووي للمنطقة من 87.2 إلى 89.2 دقيقة. نوكل. الدقة الأحماض. 21: 3391 - 3398

Pommier J ، Mandrand M-A ، Holt SE ، Boxer DH & amp Giordano G (1992) ثاني فينازين مرتبط بميثوسلفات إنزيم ديهيدروجينيز فيالإشريكية القولونية. بيوكيم. بيوفيز. اكتا 1107: 305-313

Przybyla AE و Menon NK و Robbins J و DerVartanian L & amp Peck HD (1991).مرحبا وhyb أوبراالإشريكية القولونية. في: ملخصات 3 بحث وتطوير المؤتمر الدولي حول البيولوجيا الجزيئية لانزيمات الهيدروجين. ترويا ، البرتغال

Przybyla AE، Robbins J، Menon N & amp Peck HD (1992) علاقات الهيكل والوظيفة بين هيدروجينازات النيكل المحتوية على النيكل. FEMS ميكروبيول. القس 88: 109-136

رابين آر إس ، كولينز لوس أنجلوس وأمبير ستيوارت الخامس (1992)في الجسم الحي شرط عامل مضيف التكامل لنار (اختزال النترات) أوبراون فيالإشريكية القولونية K-12. بروك. ناتل. أكاد. علوم. الولايات المتحدة الأمريكية 89: 8701-8705

Rabin RS & amp Stewart V (1992) كلاهما من بروتيني المستشعر الزائدين وظيفيًا ، NarX و NarQ ، كافٍ لتنظيم النترات فيالإشريكية القولونية K-12. بروك. ناتل. أكاد. علوم. الولايات المتحدة الأمريكية 89: 8419-8423

Rabin RS & amp Stewart V (1993) تتفاعل منظمات الاستجابة المزدوجة (NarL و NarP) مع مستشعرات مزدوجة (NarX و NarQ) للتحكم في التعبير الجيني المنظم بالنترات والنتريت فيالإشريكية القولونية K-12. J. باكتيريول. 175: 3259 - 3268

Radman M، Wagner RE، Glickman BW & amp Meselson M (1980) تصحيح عدم تطابق مثيلة الحمض النووي والاستقرار الجيني ، في: Alecivic M (Ed) Progress in Environmental Mutagenesis (pp 121–130). إلسفير ، أمستردام

Rajagopalan KV & amp Johnson JL (1992) العوامل المساعدة الموليبدينوم البتيرين. J. بيول. تشيم. 267: 10199-10202

Rey L ، و Murillo J ، و Hernando Y ، و Hidalgo E ، و Cabrera E ، و Imperial J & amp Ruiz-Argüeso T (1993) التحليل الجزيئي للأوبرون المستحث بالهوائي المجهري اللازم لتخليق هيدروجينيز فيريزوبيوم ليجومينوساروم بف.فيكيا. مول. ميكروبيول. 8: 471-481

Rivers SL و McNairn E و Blasco F و Giordano G & amp Boxer DH (1993) التحليل الجيني الجزيئيموا مشغلالإشريكية القولونية K-12 مطلوب لتخليق الموليبدينوم الحيوي. مول. ميكروبيول. 8: 1071-1082

Rohde M و Furstenau V و Mayer F و Przybyla AE و Peck HD و LeGall J و Choi E-S & amp Menon NK (1989) توطين الهيدروجين المرتبط بالغشاء (NiFe) و (NiFeSe)Desulfovibrio vulgaris باستخدام الإجراءات المجهرية المناعية. يورو. J. Biochem. 180: 421-427

Rossmann R ، Sauter M ، Lottspeich F & amp Böck A (1994) نضوج الوحدة الفرعية الكبيرة (HycE) من hydrogenase 3 منالإشريكية القولونية يتطلب دمج النيكل متبوعًا بمعالجة المحطة C في Arg537. يورو. J. Biochem. (في الصحافة)

Rossmann R و Sawers G & amp Böck A (1991) آلية تنظيم مسار فورمات الهيدروجين بواسطة الأكسجين والنترات ودرجة الحموضة: تعريف مادة الفورمات. مول. ميكروبيول. 5: 2807-2814

Ruiz-Herrera J & amp Alvarez A (1972) دراسة فسيولوجية لمادة فورمات ديهيدروجينيز ، فورمات أوكسيديز وهيدروجينلياز منالإشريكية القولونية K-12. أنتونيك فان ليوينهوك 38: 479-491

Ruiz-Herrera J & DeMoss JA (1969) Nitrate reductase complex ofالإشريكية القولونية K-12: participation of specific formate dehydrogenase and cytochromeب 1 components in nitrate reduction. J. Bacteriol. 99: 720–729

Ruiz-Herrera J, Showe MK & DeMoss JA (1969) Nitrate reductase complex ofالإشريكية القولونية K-12: isolation and characterisation of mutants unable to reduce nitrate. J. Bacteriol. 97: 1291–1297

Sankar P, Lee JH & Shanmugam KT (1985) Cloning of hydrogenase genes and fine structure analysis of an operon essential for hydrogen metabolism inالإشريكية القولونية. J. Bacteriol. 162: 353–360

Sankar P, Lee JH & Shanmugam KT (1988) Gene-product relationships offhlA وfdv genes ofالإشريكية القولونية. J. Bacteriol. 170: 5440–5445

Sankar P & Shanmugam KT (1988a) Biochemical and genetic analysis of hydrogen metabolism inالإشريكية القولونية: thehydB gene. J. Bacteriol. 170: 5433–5439

Sankar P & Shanmugam KT (1988b) Hydrogen metabolism inالإشريكية القولونية: biochemical and genetic evidence for ahydF الجين. J. Bacteriol. 170: 5446–5451

Santini C-L, Iobbi-Nivol C, Romane C, Boxer DH & Giordano G (1992) Molybdoenzyme biosynthesis inالإشريكية القولونية: in vitro activation of purified nitrate reductase from achlB متحولة. J. Bacteriol. 174: 7934–7940

Sauter M, Böhm R & Böck A (1992) Mutational analysis of the operon (hyc) determining hydrogenase 3 formation inالإشريكية القولونية. مول. ميكروبيول. 6: 1523–1532

Sawers G (1985) Membrane-bound hydrogenase isoenzymes fromالإشريكية القولونية. دكتوراه. thesis, University of Dundee

Sawers G (1993) Specific transcriptional requirements for positive regulation of the anaerobically induciblepfl operon by ArcA and FNR. مول. ميكروبيول. 10: 737–747

Sawers G & Böck A (1988) Anaerobic regulation of pyruvate formate-lyase fromالإشريكية القولونية K-12. J. Bacteriol. 170: 5330–5336

Sawers G & Böck A (1989) Novel transcriptional control of the pyruvate formate-lyase gene: upstream regulatory sequences and multiple promoters regulate anaerobic expression. J. Bacteriol. 171: 2485–2498

Sawers G, Heider J, Zehelein E & Böck A (1991) Expression and operon structure of thesel genes ofالإشريكية القولونية and identification of a third selenium-containing formate dehydrogenase isoenzyme. J. Bacteriol. 173: 4983–4993

Sawers G & Suppmann B (1992) Anaerobic induction of pyruvate formate-lyase gene expression is mediated by the ArcA and FNR proteins. J. Bacteriol. 174: 3474–3478

Sawers RG, Ballantine SP & Boxer DH (1985) Differential expression of hydrogenase isoenzymes inالإشريكية القولونية K-12: evidence for a third isoenzyme. J. Bacteriol. 164: 1324–1331

Sawers RG & Boxer DH (1986) Purification and properties of membrane-bound hydrogenase isoenzyme 1 from anaerobically grownالإشريكية القولونية K12. يورو. J. Biochem. 156: 265–275

Sawers RG, Jamieson DJ, Higins CF & Boxer DH (1986) Characterisation and physiological roles of membrane-bound hydrogenase isoenzymes fromالإشريكية القولونية. J. Bacteriol. 168: 398–404

Schlensog V, Birkmann A & Böck A (1989) Mutations inعبر which affect the anaerobic expression of a formate dehydrogenase (fdhF) structural gene. قوس. ميكروبيول. 152: 83–89

Schlensog V & Böck A (1990) Identification and sequence analysis of the gene encoding the transcriptional activator of the formate hydrogenlyase system ofالإشريكية القولونية. مول. ميكروبيول. 4: 1319–1327

Schlensog V & Böck A (1991) TheEscherichia coli fdv gene probably encodes MutS and is located at minute 58.8 adjacent to thehyc-hyp gene cluster. J. Bacteriol. 173: 7414–7415

Schlensog V, Lutz S & Böck A (1994) Purification and DNA-binding properties of FHLA, the transcriptional activator of the formate hydrogenlyase system fromبكتريا قولونية. J. بيول. تشيم. in press

Schlindwein C, Giordano G, Santini C-L & Mandrand-Berthelot M-A (1990) Identification and expression of theEscherichia coli fdhD وfdhE genes, which are involved in the formation of respiratory formate dehydrogenase. J. Bacteriol. 172: 6112–6121

Schlindwein C & Mandrand M-A (1991) Nucleotide sequence of thefdhE gene involved in respiratory formate dehydrogenase formation inالإشريكية القولونية K-12. Gene 97: 147–148

Schröder I, Darie S & Gunsalus RP (1992) Activation of theالإشريكية القولونية nitrate reductase (narGHJI) operon by NarL and FNR requires integration host factor. J. بيول. تشيم. 268: 771–774

Scott RH & DeMoss JA (1976) Formation of the formate-nitrate electron transport pathway from inactive components inالإشريكية القولونية. J. Bacteriol. 126: 478–486

See YP & Glick BR (1982) Analysis of the expression of cloned genes using anالإشريكية القولونية cell-free system. علبة. J. Biochem. 60: 1095–1100

Shanmugam KT, Stewart V, Gunsalus RP, Boxer DH, Cole JA, Chippaux M, DeMoss JA, Giordano G, Lin ECC & Rajagopalan KV (1992) Proposed nomenclature for the genes involved in molybdenum metabolism inالإشريكية القولونية وSalmonella typhimurium. مول. ميكروبيول. 6: 3452–3454

Shuber AP, Orr EC, Recny MA, Schendel PF, May HD, Schauer NL & Ferry JG (1986) Cloning, expression, and nucleotide sequence of the formate dehydrogenase genes fromMethanobacterium formicicum. J. بيول. تشيم. 261: 12943–12947

Shum A & Murphy JC (1972) Effects of selenium compounds on formate metabolism and coincidence of selenium-75 incorporation and formic dehydrogenase activity in cell-free preparations ofالإشريكية القولونية. J. Bacteriol. 110: 447–449

Spiro S & Guest JR (1990) FNR and its role in oxygen-regulated gene expression inالإشريكية القولونية. FEMS Microbiol. Rev. 75: 399–428

Stadtman TC (1990) Selenium biochemistry. Annu. Rev. Biochem. 59: 111–127

Stadtman TC, Davis JN, Ching W-M, Zinoni F & Böck A (1991) Amino acid sequence analysis ofالإشريكية القولونية formate dehydrogenase (FDH ح) confirms that TGA in the gene encodes selenocysteine in the gene product. BioFactors 3: 21–27

Stadtman TC, Davis JN, Zehelein E & Böck A (1989) Biochemical and genetic analysis ofSalmonella typhimurium والإشريكية القولونية mutants defective in specific incorporation of selenium into formate dehydrogenase and tRNAs. BioFactors 2: 35–44

Stephenson M & Stickland LH (1931) Hydrogenase: a bacterial enzyme activating molecular hydrogen. I. The properties of the enzyme. بيوتشيم. J. 25: 205–214

Stephenson M & Stickland LH (1932) Hydrogenlyases. Bacterial enzymes liberating molecular hydrogen. بيوتشيم. J. 26: 712–724

Stewart V (1988) Nitrate respiration in relation to facultative metabolism in enterobacteria. ميكروبيول. Rev. 52: 190–232

Stewart V (1993) Nitrate regulation of anaerobic respiratory gene expression inالإشريكية القولونية. مول. ميكروبيول. 9: 425–434

Stewart V & Berg BL (1988) Influence ofnar (nitrate reductase) genes in nitrate inhibition of formate-hydrogen lyase and fumarate reductase gene expression inالإشريكية القولونية K-12. J. Bacteriol. 170: 4437–4444

Stewart V, Lin JT & Berg BL (1991) Genetic evidence that genesfdhD وfdhE do not control synthesis of formate dehydrogenase-N inالإشريكية القولونية K-12. J. Bacteriol. 173: 4417–4423

Stewart V & MacGregor CH (1982) Nitrate reductase inالإشريكية القولونية K-12: involvement ofchlC, chlE وchlG loci. J. Bacteriol. 151: 788–799

Stoker K, Oltmann LF & Stouthamer AH (1988) Partial characterisation of an electrophoretically labile hydrogenase activity ofالإشريكية القولونية K-12. J. Bacteriol. 170: 1220–1226

Stoker K, Oltmann LF & Stouthamer AH (1989a) Randomly inducedالإشريكية القولونية K-12 Tn5 insertion mutants defective in hydrogenase activity. J. Bacteriol. 171: 831–836

Stoker K, Reijnders WNM, Oltmann LF & Stouthamer AH (1989b) Initial cloning and sequencing ofhydGH, an operon homologous tontrBC and regulating the labile hydrogenase activity inالإشريكية القولونية K-12. J. Bacteriol. 171: 4448–4456

Suppmann B & Sawers G (1994) Isolation and characterisation of hypophsphite-resistant mutants ofالإشريكية القولونية: identification of the FocA protein, encoded nby thepfl operon, as a putative formate transporter. مول. ميكروبيول. 11: 965–982

Tomiyama M, Shiotani M, Sode K, Tamiya E & Karube I (1991) Nucleotide sequence analysis and expression control ofhydA فيالإشريكية القولونية. In: Abstracts of 3 rd International Conference on the Molecular Biology of Hydrogenases. Troia, Portugal

Van der Zwaan JW, Albracht SPJ, Fontijn RD & Slater EC (1985) Monovalent nickel in hydrogenase fromChromatium vinosum: light sensitivity and evidence for direct interaction with hydrogen. FEBS ليت. 179: 271–277

Veres Z, Tsai L, Scholz TD, Politino M, Balaban RS & Stadtman TC (1992) Synthesis of 5-methylaminomethyl-2-selenouridine in tRNAs: 31 P NMR studies show how the labile selenium donor synthesised by theselD gene product contains selenium bonded to phosphorus. بروك. ناتل. أكاد. علوم. USA 89: 2975–2979

Vignais PM & Toussaint B (1994) Molecular biology of membrane-bound H2 uptake hydrogenases. قوس. ميكروبيول. 161: 1–10

Voordouw G (1992) Evolution of hydrogenase genes. حال. Inorg. تشيم. 38: 397–422

Wagner AFV, Frey M, Neugebauer FA, Schäfer W & Knappe J (1992) The free radical in pyruvate formate-lyase is located on glycine-734. بروك. ناتل. أكاد. علوم. USA 89: 996–1000

Waugh R & Boxer DH (1986) Pleiotropic hydrogenase mutants ofالإشريكية القولونية K12: growth in the presence of nickel can restore hydrogenase activity. Biochimie 68: 157–166

Weiss H, Friedrich T, Hofhaus G & Preis D (1991) The respiratory chain NADH dehydrogenase (complex I) of mitochondria. يورو. J. Biochem. 197: 563–576

Wendt JC, Maupin JA & Shanmugam KT (1991) Physiological and genetic regulation of dihydrogen metabolism inالإشريكية القولونية. In: Abstracts of the 3 rd International Conference on the Molecular Biology of Hydrogenses. Troia, Portugal

Wimpenny JWT & Cole JA (1967) The regulation of metabolism in facultative bacteria. ثالثا. The effect of nitrate. بيوكيم. بيوفيز. Acta 148: 133–242

Wu L-F & Mandrand-Berthelot M-A (1986a) Molecular cloning of thefdhF gene ofالإشريكية القولونية K-12. FEMS Microbiol. بادئة رسالة. 34: 323–327

Wu L-F & Mandrand M-A (1993) Microbial hydrogenases: primary structure, classification, signatures and phylogeny. FEMS Microbiol. Rev. 104: 243–270

Wu L-F & Mandrand-Berthelot M-A (1986b) Genetic and physiological characterisation of newالإشريكية القولونية mutants impaired in hydrogenase activity. Biochimie 68: 167–179

Wu L-F & Mandrand-Berthelot M-A (1987) Regulation of thefdhF gene encoding the selenopolypeptide for benzyl viologen-linked formate dehydrogenase inالإشريكية القولونية. مول. Gen. Genet. 209: 129–134

Wu L-F, Mandrand-Berthelot M-A, Waugh R, Edmonds CJ, Holt SE & Boxer DH (1989) Nickel deficiency gives rise to the defective hydrogenase phenotype ofhydC وfnr mutants inالإشريكية القولونية. مول. ميكروبيول. 3: 1709–1718

Wu L-F, Navarro C & Mandrand-Berthelot M-A (1991) ThehydC region contains a multi-cistronic operon (nik) involved in nickel transport inالإشريكية القولونية. Gene 107: 37–42

Yamamoto I & Ishimoto M (1978) Hydrogen-dependent growth ofالإشريكية القولونية in anaerobic respiration and the presence of hydrogenases with different functions. J. Biochem. (Tokyo) 84: 673–679

Yamamoto T, Tomiyama M, Mita H, Sode K & Karube I (1990) Identification of protcins encoded inEscherichia coli hydA, hydB and analysis of thehydA locus. FEMS Microbiol. بادئة رسالة. 66: 187–192

Yerkes JH, Casson LP, Honkanen AK & Walker GC (1984) Anaerobiosis induces expression ofant, a newالإشريكية القولونية locus with a role in anaerobic electron transport. J. Bacteriol. 158: 180–186

Zinoni F, Beier A, Pecher A, Wirth R & Böck A (1984) Regulation of the synthesis of hydrogenase (formate hydrogen-lyase linked) ofبكتريا قولونية. قوس. ميكروبيول. 139: 299–304

Zinoni F, Birkmann A, Leinfelder W & Böck A (1987) Cotranslational insertion of selenocysteine into formate dehydrogenase fromالإشريكية القولونية directed by a UGA codon. بروك. ناتل. أكاد. علوم. USA 84: 3156–3160

Zinoni F, Birkmann A, Stadtman TC & Böck A (1986) Nucleotide sequence and expression of the selenocysteine-containing polypeptide of formate dehydrogenase (formate-hydrogen-lyaselinked) fromالإشريكية القولونية. بروك. ناتل. أكاد. علوم. USA 83: 4650–4654


خلفية

Hydrogenases catalyze the simplest of all chemical reactions: the reduction of protons to molecular hydrogen or والعكس صحيح. Depending on the metal content of the active site hydrogenases are classified into Fe-, NiFe-, and metal-free hydrogenases [1]. Independent from the metal content, the enzymes are characterized as hydrogen uptake, bidirectional and hydrogen evolving hydrogenases, indicating their actual في الجسم الحي نشاط. A prominent and evolutionary old group of organisms possessing NiFe-hydrogenases are phototrophic cyanobacteria (formerly blue-green algae) [2]. All cyanobacteria investigated so far, express an uptake, a bidirectional or both NiFe-hydrogenases [2-6]. The uptake hydrogenase is a dimeric enzyme consisting of a large subunit (HupL) containing the active site and a small subunit (HupS) with several FeS-clusters. The physiological role of the uptake hydrogenase appears to be coupled to nitrogen fixation [7-9]: the hydrogen evolved as a by-product from nitrogenase activity can be recycled by the action of the uptake hydrogenase [2]. Consequently, the uptake hydrogenase is found in nitrogen-fixing cyanobacteria only [2,10]. The bidirectional hydrogenase consists of an electron transmitting and anchoring diaphorase part (HoxFU), an active site containing large subunit (HoxH) and a FeS-cluster harboring small subunit (HoxY) [3,11]. The presence of a third diaphorase subunit (HoxE) has been demonstrated for Anacystis nidulans (Synechococcus PCC 6301) and Synechocystis PCC 6803 [12]. Neither is the bidirectional hydrogenase universally distributed among cyanobacteria nor is its function clearly understood, yet [2].

The maturation of nickel-containing enzymes, e.g. hydrogenases, ureases, and carbonmonoxide dehydrogenases, is a complex process requiring accessory proteins [13-19]. For hydrogenases, the first experimental results were obtained from الإشريكية القولونية. A number of mutations in the 58� min region of the بكتريا قولونية chromosome (location 2848670� in بكتريا قولونية strain K12 genome [20]) affect the biosynthesis of all NiFe-hydrogenases of this organism [21]. Sequencing of this region revealed 5 ORFs, which were designated hypABCDE, indicating that these genes affect hydrogenases صleiotropically [22] and which were to be the first identified genes associated with hydrogenase maturation. Later on, hyp homologous genes were also identified in cyanobacteria (see [2] and references therein).

One distinct step in NiFe-hydrogenases maturation is the endoproteolytic cleavage of a C-terminal peptide (ca. 30 amino acids) of the large subunit precursor [19]. بكتريا قولونية is able to synthesize at least three NiFe-hydrogenases (operons hya, hyb و hyc, encoding hydrogenase 1, 2 and 3, respectively). In addition, the operon for a fourth hydrogenases (operon hyf, encoding hydrogenase 4) has been identified but its functional expression has not been proven yet [23]. Hydrogenases 1 and 2 have been shown to be involved in anaerobic hydrogen oxidation for energy production [24-27], whereas hydrogenase 3 is part of the formate-hydrogen-lyase complex and catalyzes the evolution of hydrogen from formate [28]. Each hydrogenase isoenzyme large subunit is proteolytically processed by a corresponding specific C-terminal endopeptidase (i.e. HyaB by HyaD, HybC by HybD and HycE by HycI). There has been no peptidase identified for HyfG yet. The peptidases cleave the hydrogenase large subunit precursor proteins after a histidine or arginine residue in the C-terminal consensus motif DPCxxCxx(H/R) liberating a short polypeptide (Table ​ (Table1) 1 ) [29-32]. The first crystal structure from a NiFe-hydrogenase of the sulfate reducing bacterium Desulfovibrio gigas [33] revealed that those conserved cysteines are ligands to the NiFe-active site of hydrogenases. The endopeptidase HybD, responsible for proteolytic maturation of the precursor of the large subunit from hydrogenase 2 of بكتريا قولونية, has been overexpressed and crystallized [34]. X-ray analysis of the crystal structure revealed the presence of three amino acid residues, which are involved in metal binding (Glu16, Asp62, and His93). Recognition of the hydrogenase by the peptidase does not depend on the cleavage site consensus sequence but is mediated by the overall 3-dimensional hydrogenase and peptidase protein structures [35,36]. Until now, nothing is known about the maturation of cyanobacterial NiFe-hydrogenases. Previously, we cloned, sequenced and characterized a hyp-operon from the heterocystous nitrogen-fixing cyanobacterium Nostoc punctiforme ATCC 29133/PCC 73102 [37]. The availability of three completed cyanobacterial genomes from organisms with either only the uptake (Nostoc punctiforme ATCC 29133/PCC 73102 [38]), only the bidirectional (Synechocystis PCC 6803 [39,40]) or both NiFe-hydrogenases (أنابينا PCC 7120 [41]) prompted us to mine these genomes for hydrogenase-related genes. In this communication we focus on the presence and the expression of the NiFe-hydrogenases and the corresponding putative hydrogenase specific C-terminal endopeptidases in these three strains.

الجدول 1

The C-terminal part of deduced cyanobacterial hydrogenase large subunit amino acid sequences. Cyanobacterial sequences in the focus of this study are shown in bold. The accession number and the C-terminal protein sequence follow the gene name. The putative cutting site is represented by a gap. As reference, the cutting sites of الإشريكية القولونية hydrogenase large subunits are shown. Corresponding GenBank accession numbers are indicated. The consensus sequence D(P/S)CxxCxx(H/R) is shown in italic letters.

Synechocystis PCC 6803
HoxH <"type":"entrez-protein","attrs":<"text":"CAA66212.1","term_id":"1771720">> CAA66212.1-NRVEAGIRCYDPCLSCSTHAAGQMPLMIDLVNPQGELIKSIQRD
Nostoc ATCC 29133
HupL <"type":"entrez-protein","attrs":<"text":"AAC16277.1","term_id":"3132511">> AAC16277.1-VEVGHVARSFDSCLVCTVHAHDAKTGEELARFRTA
أنابينا PCC 7120
HupL <"type":"entrez-protein","attrs":<"text":"AAC79878.1","term_id":"520460">> AAC79878.1-VEVGHVARSFDSCLVCTVHAHDAKTGEELARFRTA
HoxHNP_484809-NRVEAGIRAFDPCLSCSTHAAGQMPLHIQLVAADGNIVNQVWRE
Anabaena variabilis
HupL <"type":"entrez-protein","attrs":<"text":"CAA73659.2","term_id":"12666972">> CAA73659.2-VEVGHVARSFDSCLVCTVHAHDAKTGEELARFRTA
HoxH <"type":"entrez-protein","attrs":<"text":"CAA55878.1","term_id":"1032481">> CAA55878.1-NRVEAGIRAFDPCLSCSTHAAGQMPLHIQLVAANGNIVNQVWREKLGV
Synechococcus PCC 6301
HoxH <"type":"entrez-protein","attrs":<"text":"CAA66383.1","term_id":"1708772">> CAA66383.1-NRVEAGIRCFDPCLSCSTHTAGQMPLKIEIFDSRGELYQCLCRDL
Prochlorothrix hollandica
HoxH <"type":"entrez-protein","attrs":<"text":"AAB53705.1","term_id":"2072171">> AAB53705.1-NRVEAGIPCYDPCLSCSTHAAAKCPSMWNWWVPTAPLSRKRCGLGQRVPRF
الإشريكية القولونية
HyaB <"type":"entrez-protein","attrs":<"text":"AAA23998.1","term_id":"146421">> AAA23998.1-LEILRTLHSFDPCLACSTHVLGDDGSELISVQVR
HybC <"type":"entrez-protein","attrs":<"text":"AAA21591.1","term_id":"544485">> AAA21591.1-LEVVRTIHSFDPCMACAVHVVDADGNEVVSVKVL
HycE <"type":"entrez-protein","attrs":<"text":"CAA35550.1","term_id":"41684">> CAA35550.1-SDAPLIIGSLDPCYSCTDRMTVVDVRKKKSKVVPYKELERYSIERKNSPLK

الاستنتاجات

The extraordinary capacity of eukaryotes to repeatedly evolve organelles capable of producing hydrogen (hydrogenosomes) is a fascinating biological puzzle. Some have hypothesized that the genes encoding the key enzymes PFO and hydrogenase were acquired only once in eukaryotic evolution and have subsequently been retained ( Embley, Horner, and Hirt 1997 Martin and Müller 1998 ). Under this scenario, the enzymes for hydrogen production might be readily available for recruitment into the compartment destined to become a hydrogenosome, with the mitochondrion being favored by the available data (for review, see Embley, Horner, and Hirt 1997 Martin and Müller 1998 Hackstein et al. 1999 ). Recent analyses have demonstrated that eukaryotic cytosolic and hydrogenosomal PFO from diverse eukaryotes, including Entamoeba, Giardia, Spironucleus, و Trichomonas, do form a monophyletic group, which is consistent with the ancestral acquisition and retention hypothesis for this particular enzyme ( Horner, Hirt, and Embley 1999 ). In the present investigation, we focused on the origins of hydrogenase, the canonical enzyme for hydrogenosomes ( Müller 1993 ). Our analyses suggest, albeit with relatively weak support, that cytosolic and hydrogenosomal [Fe] hydrogenases from Entamoeba, Spironucleus, و Trichomonas are also monophyletic. Thus, the available data and analyses are consistent with the hypothesis that the common, perhaps also anaerobic, ancestor of these species and, potentially, other eukaryotes contained genes for both PFO and [Fe] hydrogenase.

Two recently published hypotheses have postulated that eukaryotic cells originated through a symbiosis between two prokaryotes, and each posits that interspecies hydrogen transfer was the key to binding one partner to the other. In the hydrogen hypothesis, the prokaryotes comprise an anaerobic hydrogen-consuming archaebacterium (the host) and a hydrogen-producing facultative anaerobic α-proteobacterium (the symbiont), with the α-proteobacterium subsequently becoming the mitochondrion ( Martin and Müller 1998 ). The syntrophic hypothesis posits that eukaryotes arose from a primary symbiosis between an anaerobic hydrogen-consuming methanogenic archaebacterium which became the nucleus and an anaerobic hydrogen-producing δ-proteobacterium which became the host, with mitochondria originating from a later symbiosis involving a facultatively anaerobic methane-consuming α- proteobacterium ( Moreira and Lopez-Garcia 1998 ). While they differ in key features, both hypotheses can be interpreted to predict that PFO and hydrogenase were present early in eukaryotic evolution, a prediction for which our present and previous analyses provide some support. However, our analyses failed to identify a eubacterial sister group for either enzyme and thus cannot discriminate between the hydrogen and syntrophic hypotheses regarding the identity of a potential eubacterial donor for eukaryotic enzymes. This situation may improve with more sampling—particularly of α- and δ-proteobacterial genes. However, unless the trees for PFO and [Fe] hydrogenase can be rooted, it may remain difficult to identify a potential source for ancestral enzymes.

Trees where the [Fe] hydrogenase from the hydrogenosomal ciliate N. ovalis was constrained to be monophyletic with the other eukaryote sequences were rejected by our analyses. The favored position for the Nyctotherus sequence was as the sister group to a [Fe] hydrogenase on the genome of the eubacterium D. vulgaris. Thus, as previously suggested ( Akhmanova et al. 1998 ) it seems possible that Nyctotherus has obtained its hydrogenosomal [Fe] hydrogenase from a different source (either from a different paralog or via horizontal transfer) from Trichomonas for its hydrogenosomes.

William Martin, Reviewing Editor

Abbreviations: HC, hydrogenase catalytic FeS cluster PFO, pyruvate : ferredoxin oxidoreductase.


Synthetic Methods VI – Enzymatic and Semi-Enzymatic

H. Gröger , . R. Metzner , in Comprehensive Chirality , 2012

7.10.4.9 (ر)-Specific NADPH-Dependent ADH from Lactobacillus kefir و L. brevis

These ADHs, which represent two quite homologous enzymes, were found to be valuable biocatalysts for the preparation of (ر)-hydroxy compounds. من عند Lactobacillus kefir DSM 20587, the adh gene encoding a protein of 252 amino acids (Lk-ADH) could be isolated. The deduced amino acid sequence indicated that this enzyme belongs to the family of short-chain dehydrogenases . The enzyme was cloned and expressed in بكتريا قولونية, purified, and characterized biochemically. 133 For the reduction of acetophenone, the specific activity of the homogeneous recombinant ADH was 558 U mg −1 . The enzyme shows its maximum activity at 50 °C. The three-dimensional structure was resolved by X-ray with a resolution of at least 1.8 Å. 134 Lk-ADH was applied, meanwhile, for the reduction of a broad range of aliphatic and aromatic ketones as well as β-keto esters. The enzyme was also used as a biocatalyst in the chemoenzymatic synthesis of the chiral side-chain of statins, 135–138 the enantioselective preparation of multifunctionalized propargylic building blocks, 139,140 and in several one-pot reactions carried out in an aqueous medium under a combination of ‘classic’ chemical or chemocatalytic reaction steps with biocatalysis. 141–145 The enantioselective reduction of acetophenones bearing ‘free,’ nonprotected hydroxyl groups by means of this biocatalyst has been reported as well. 146 All prochiral ketones were stereoselectively reduced to the corresponding alcohols with typically excellent enantioselectivities of >99% ee in most cases. When using diketones as substrates, diastereoselectivities of >99% de have been achieved.


Roles of Coenzyme F420-Reducing Hydrogenases and Hydrogen- and F420-Dependent Methylenetetrahydromethanopterin Dehydrogenases in Reduction of F420 and Production of Hydrogen during Methanogenesis

FIG. 1. The hydrogenotrophic methanogenic pathway. See reference 3 for a full description of methanogenesis. The Hmd-Mtd cycle is boxed. Abbreviations: CoB, coenzyme B CoM, coenzyme M F420, coenzyme F420 Fd, ferredoxin Frc, cysteine-containing F420-reducing hydrogenase Fru, selenocysteine-containing F420-reducing hydrogenase Mer, methylenetetrahydromethanopterin reductase MFR, methanofuran. FIG. 2. Growth and H2 production by wild-type and mutant strains of M. maripaludis. (A) Growth on H2 (B) growth and H2 production on formate. For the Δmtd mutant on formate, data from three separate growth experiments are plotted and are represented by a single line. OD660, optical density at 660 nm.

B5. Hydrogenases (not dehydrogenases) - Biology

A series of four [S<sub>2</sub>Ni­(μ-S)<sub>2</sub>FeCp*Cl] compounds with different tetradentate thiolate/thioether ligands bound to the Ni­(II) ion is reported (Cp* = C<sub>5</sub>Me<sub>5</sub>). ال core of these compounds resembles structural features of the active site of [NiFe] hydrogenases. Detailed analyses of the electronic structures of these compounds by Mössbauer and electron paramagnetic resonance spectroscopy, magnetic measurements, and density functional theory calculations reveal the oxidation states Ni­(II) low spin and Fe­(II) high spin for the metal ions. The same electronic configurations have been suggested for the C<sub>red1</sub> state of the C-cluster [NiFe<sub>u</sub>] subsite in carbon monoxide dehydrogenases (CODH). The Ni–Fe distance of ∼3 Å excludes a metal–metal bond between nickel and iron, which is in agreement with the computational results. Electrochemical experiments show that iron is the redox active site in these complexes, performing a reversible one-electron oxidation. The four complexes are discussed with regard to their similarities and differences both to the [NiFe] hydrogenases and the C-cluster of Ni-containing CODH

To submit an update or takedown request for this paper, please submit an Update/Correction/Removal Request.


الملخص

A series of four [S2Ni(μ-S)2FeCp*Cl] compounds with different tetradentate thiolate/thioether ligands bound to the Ni(II) ion is reported (Cp* = C5أنا5). ال <>2Ni(μ-S)2Fe> core of these compounds resembles structural features of the active site of [NiFe] hydrogenases. Detailed analyses of the electronic structures of these compounds by Mössbauer and electron paramagnetic resonance spectroscopy, magnetic measurements, and density functional theory calculations reveal the oxidation states Ni(II) low spin and Fe(II) high spin for the metal ions. The same electronic configurations have been suggested for the Cred1 state of the C-cluster [NiFeش] subsite in carbon monoxide dehydrogenases (CODH). The Ni–Fe distance of ∼3 Å excludes a metal–metal bond between nickel and iron, which is in agreement with the computational results. Electrochemical experiments show that iron is the redox active site in these complexes, performing a reversible one-electron oxidation. The four complexes are discussed with regard to their similarities and differences both to the [NiFe] hydrogenases and the C-cluster of Ni-containing CODH.


شاهد الفيديو: 8 G6PD deficiency انيميا الفول- انيميا نقص انزيم سداسي الجلوكوز الفوسفاتي نازع الهيدروجين (كانون الثاني 2022).