معلومة

ما هي تكلفة أليغنوكليوتيد 5 'pGpGpApCpT 3' عند الرقم الهيدروجيني 7.00؟


ما شحنة النيوكليوتيد 5'pGpGpApCpT 3 '@ pH 7.00؟

اعتقدت أن الأدينين يحتوي على 1نيو هامبشايرالمجموعة وجوانين لديهانيو هامبشايروأوهالمجموعات و السيتوزين و الثايمينأوهالمجموعات الموجودة عليه والفوسفات عند 5 'نهاية أأوهفي 3 'end. كذلك عند pH 2.00-3.00أوهسوف يعطي إلكترونًا ويصبح سالبًا ، فهل هو + 2 + 2-1-1-1 وهو -1؟ يرجى توضيح؟


لم أفهم تمامًا من أين تحصل على كل مجموعات OH ، ربما من تواتومرات enol للنيوكليوتيدات. حاولت البحث عن pKa بحثًا عن توتومرات كيتو للنيوكليوتيدات على ويكيبيديا 1،2،3،4.

بشكل عام ، إذا كان الرقم الهيدروجيني أقل من pKa لمجموعة وظيفية ، فسيتم بروتون تلك المجموعة ، وإذا كان الرقم الهيدروجيني أعلى من pKa ، فسيتم فصله ، على الرغم من أن هذا هو التوازن.

إذا افترضنا أن الرقم الهيدروجيني 7 وافترض أن لدي pKas الصحيح (هذه القيم للأحماض النووية الحرة ، لا يوجد ديوكسيريبوز مرفق) ، فإن الأمينات الأولية في A و G و C ستكون مجموعات NH3 بروتونية بشحنات موجبة. يجب أن تظل على G و T غير مشحونة وغير مشحونة.

إذن باستخدام التسلسل GGACT ، لدينا 4 أمينات أولية ، أي 4 شحنة موجبة. ومع ذلك ، لدينا أيضًا 5 فوسفات ، كل منها يحمل شحنة سالبة ، لذا +4 زائد -5 يساوي -1.

بالطبع كل هذا يخرج من النافذة بمجرد ربط قليل النوكليوتيد هذا بأوليغنوكليوتيد آخر ، أفترض أن الرابطة الهيدروجينية ستغير pKas والشحنات. لكل ما أعرفه ، فإن مجرد ربط الأحماض النووية بمركب الديوكسيريبوز وتكديسها معًا يغير pKas.


لا توجد شحنة موجبة على القواعد عند الرقم الهيدروجيني 7 ، ولكن هناك 4 روابط فوسفوديستر لها شحنة -1 على كل فوسفات ، لذا فإن المجموع -4 أيضًا الفوسفات النهائي عند 5 بوصات مجاني ، لذا فهو يحتوي على شحنة -2. وبالتالي فإن الشحنة الإجمالية للقليل النوكليوتيد هي -4-2 = -6 (يحددها عدد مجموعات الفوسفات)


لا توجد شحنة موجبة على القواعد عند الرقم الهيدروجيني 7 ، وبالتالي فإن الشحنة الإجمالية للأوليغنوكليوتيد هي -4 (يحددها عدد مجموعات الفوسفات) ... انظر التفاصيل هنا: https://books.google.cz/books؟id=v9HL5VyRmZcC&lpg = PA204 & ots = DQYKZ9PxXg & dq = لماذا٪ 20amino٪ 20group٪ 20of٪ 20nucleo٪ 20bases٪ 20protonated & pg = PA204 # v = on page & q = why٪ 20amino٪ 20group٪ 20of٪ 20nucleo٪ 20bases٪ 20protonated & f = false


الانقسام الملزم والمحاكاة الحيوية لبولي RNA (U) بواسطة بوليميدازول اصطناعي

تم استخدام أربع عديدات إيميدازول في دراسات الربط والانقسام باستخدام بولي (U). تم وصف البوليفينليميدازول المتعددين من قبل الآخرين ، بينما تم تحضير البوليمرين الأخريين من البولي إيثيلين أمين بواسطة البلمرة الكاتيونية للأوكسازولين. هذا الأخير كان يحتوي على وحدات إيميدازول ملحقة بكل نيتروجين من البوليمرات. كانت تتميز بالكروماتوغرافيا النفاذة للهلام ولديها نثرات تعدد منخفضة للغاية. عندما تم بروتوناتهم جزئيًا ، فقد تم ربطهم بالبولي (U) وحفزوا انقسامه من خلال عملية مماثلة لتلك المستخدمة بواسطة إنزيم ريبونوكلياز أ. كروتالوس السم بعد عمليات الانقسام. كما تم فحص انقسام بولي (U) مع Zn 2+ ، مع وبدون البوليمرات. تم وصف مخطط يمكن من خلاله جعل هذه الانقسامات متسلسلة انتقائية باستخدام RNAs مختلفة ، خاصة مع أهداف مهمة ، مثل RNAs الفيروسية.

حفزنا الطابع البوليمري للإنزيمات الطبيعية على توسيع مجال الإنزيمات الاصطناعية إلى تلك القائمة على البوليمرات الاصطناعية ، كما ذكرنا سابقًا (1). من المهم بشكل خاص أن تكون الإنزيمات الاصطناعية التي يمكن أن تشق الحمض النووي الريبي ، ويفضل أن يكون ذلك مع خصوصية التسلسل (2 ، 3). يمكن استخدامها لتدمير جزيئات الحمض النووي الريبي الفيروسية الخطيرة إذا قمنا بربط DNA قصير بالبوليمرات بالتسلسل الضروري للربط الانتقائي. سيكون هذا تقدمًا في الطب الجزيئي & # x02014 باستخدام محفز نشط بدلاً من مجرد معدل للأنظمة البيولوجية ، كما هو الحال مع الأدوية الأخرى.

لقد وصفنا طريقة تحليلية لمتابعة معدلات انقسام الحمض النووي الريبي (4) بواسطة محفزات أو متفاعلات مختلفة تقلد الآلية المستخدمة بواسطة ريبونوكلياز أ. في هذا الإنزيم ، تهاجم مجموعة هيدروكسيل الريبوز C-2 & # x02032 الفوسفات المجاورة التي يربط هيدروكسيل C-3 & # x02032 مع هيدروكسيل C-5 & # x02032 من ريبوز آخر. والنتيجة هي تكوين C-2 & # x02032 / C-3 & # x02032 فوسفات دوري ومجموعة هيدروكسيل C-5 & # x02032 متحررة. ثم نتعامل مع المنتج باستخدام فوسفوديستيراز أنا من كروتالوس السم ، الذي يشق الحمض النووي الريبي بطريقة مختلفة ، يتحلل بالماء المتبقي C-3 & # x02032 / C-5 & # x02032 رابط الفوسفات لإزالة الفوسفات من C-3 & # x02032 وتركه على C-5 & # x02032. باستخدام RNA ، تكون جميع منتجات الخطوة الثانية عبارة عن نيوكليوتيد 5 & # x02032-فوسفات باستثناء تلك التي ترك فيها الانقسام الشبيه بالريبونوكلياز موضع 5 & # x02032 دون فسفرة. مع بولي (U) كركيزة ، يترك كل موقع انشقاق أولي يشبه الريبونوكلياز يوريدين غير فسفوري بعد معالجة فسفودايستيراز I ، والذي نقوم بفحصه باستخدام HPLC الكمي. لقد أظهرنا أن هذا الاختبار لانقسام الحمض النووي الريبي الشبيه بـ RNA موثوق به من الناحية الكمية (4).

في ريبونوكلياز أ ، يتم تحفيز الانقسام بواسطة حلقات إيميدازول من هيستيدين ، أحدهما أقل أساسية مثل قاعدة إيميدازول الحرة (His-12) والآخر أكثر أساسية كاتيون إيميدازوليوم (His-119) (5). في الآلية الأكثر احتمالاً (6) ، ينزع إيميدازول His-12 مجموعة الهيدروكسيل C-2 & # x02032 حيث يضيف الأكسجين إلى الفوسفات المجاور ، ويشكل وسيطًا من الفوسفوران بمساعدة مجموعة الإيميدازوليوم الموجبة الشحنة على جهاز His-119. بروتون لأوكسيانيون الفوسفات. في الخطوات اللاحقة ، يتحلل وسيط الفوسفوران ، ويطرد مجموعة هيدروكسيل C-5 & # x02032 للوحدة التالية بينما يترك C-2 & # x02032 / C-3 & # x02032 فوسفات دوري. ثم يتحلل هذا في الخطوات اللاحقة إلى المنتج النهائي مع مجموعة فوسفات على C-3 & # x02032 ومجموعة هيدروكسيل مرة أخرى على C-2 & # x02032. لقد وصفنا أنظمة المحاكاة الحيوية التي تحاكي هذه العملية ، باستخدام إما محلول إيميدازول مركّز مع RNA نفسه (6 & # x0201310) أو cyclodextrins التي تحمل حلقات imidazole المرفقة لتشق نظائر الحمض النووي الريبي (11 & # x0201313). نحن الآن نصف انشقاقات poly (U) (& # x0003e & # x000a0300 & # x000a0units) بواسطة فئتين من polyimidazoles الاصطناعية مثل ribonuclease A ، وتشكيل مجموعة هيدروكسيل C-5 & # x02032 على ترك وحدة RNA كما هو الحال مع ribonuclease A. لدينا أيضًا دليل على ارتباط بعض البوليمرات بالحمض النووي الريبي قبل الانقسام. تم تحسين الانقسام من خلال خصائص الربط للبوليمر نفسه (مقارنة مع تلك التي لا توجد بها مواقع ربط) ، بدلاً من إضافة عوامل مساعدة كاتيون معدنية خارجية (على الرغم من أن إضافة Zn 2+ أدت إلى تحسين التحلل المائي في حالاتنا) ، مما يجعلها أكثر جذابة لمزيد من التطبيقات الخلوية.


يحتوي التطبيق الفوري على قائمة Seguence التي تم تقديمها بتنسيق ASCII عبر EFS-Web ويتم دمجها بموجب المرجع في مجملها. نسخة ASCII المذكورة ، التي تم إنشاؤها في 18 يناير 2010 ، تحمل اسم 308410US.txt وحجمها 462.420 بايت.

حقل الاختراع

الاختراع في مجال علم الفيروسات. بشكل أكثر تحديدًا ، يكون الاختراع في مجال الفيروسات التاجية.

خلفية الاختراع

متلازمة الجهاز التنفسي الحادة الوخيمة (سارس) ، تفشي الالتهاب الرئوي غير النمطي في جميع أنحاء العالم مع معدل وفيات إجمالي يبلغ حوالي 3 إلى 6 ٪ ، تُعزى إلى فيروس كورونا بعد اختبارات السببية وفقًا لافتراضات كوخ ، بما في ذلك تلقيح القرود (R. Munch ، الميكروبات تصيب 5 ، 69-74 ، يناير 2003). فيروسات كورونا هي أعضاء في عائلة من الفيروسات المغلفة التي تتكاثر في سيتوبلازم الخلايا المضيفة الحيوانية (B.N Fields et al. ، علم الفيروسات الحقول، ليبينكوت ويليامز وأمبير ويلكنز ، فيلادلفيا ، الطبعة الرابعة ، 2001). وهي تتميز بوجود جينوم الحمض النووي الريبي أحادي الجديلة زائد الإحساس ، بطول 30 كيلو بايت تقريبًا ، وله هيكل 5-غطاء و 3-بولي أ. ومن ثم فإن الجينوم هو في الأساس مرنا كبير جدًا. عند إصابة خلية مضيفة مناسبة ، يُترجم إطار القراءة المفتوح (ORF) المكون من 5 درجات (ORF) للجينوم الفيروسي إلى بروتين متعدد كبير مشقوق بواسطة البروتياز المشفر بالفيروس لإطلاق العديد من البروتينات غير الهيكلية بما في ذلك RNA المعتمد على RNA polymerase ( Pol) وطائرة ATPase (Hel). هذه البروتينات بدورها مسؤولة عن تكرار الجينوم الفيروسي وكذلك إنشاء نسخ متداخلة تستخدم في تخليق البروتينات الفيروسية. الآلية التي يتم من خلالها صنع هذه الرنا المرسال تحت الجينومية ليست مفهومة تمامًا ، ومع ذلك فإن التسلسلات المنظمة للنسخ (TRSs) عند نهاية كل جين قد تمثل إشارات تنظم النسخ المتقطع للـ mRNAs دون الجينومية (sgmRNAs). تتضمن TRSs تسلسلًا أساسيًا محفوظًا جزئيًا (CS) يكون في بعض الفيروسات التاجية 5′-CUAAAC-3. تم اقتراح نموذجين رئيسيين لشرح النسخ المتقطع في الفيروسات التاجية والفيروسات الشريانية (MMC Lai، D. Cavanagh، Adv Virus Res.48، 1 (1997) SG Sawicki، DL Sawicki، Adv. Exp. Med Biol.440، 215 ( 1998)). اكتشاف السلاسل النشطة نسبيًا ذات الحجم الجينومي ناقصًا التي تحتوي على تسلسل مضاد للقراءة ووسط النسخ النشطة في تخليق mRNAs (DL Sawicki et al.، J. Gen Virol 82، 386 (2001) SG Sawicki، DL Sawicki، J. Virol .64، 1050 (1990) M. Schaad، RSJ Baric، J. Virol. 68، 8169 (1994) PB Sethna et al.، Proc. Natl. Acad. Sci. USA 86، 5626 (1989)) تفضل نموذج النسخ المتقطع أثناء التخليق ناقص حبلا (SG Sawicki، DL Sawicki، Adv. Exp. Med Biol. 440، 215 (1998)).

يتم إدخال بروتينات غشاء الفيروس التاجي ، بما في ذلك البروتينات الرئيسية S (Spike) و M (الغشاء) ، في الحجرة الوسيطة للشبكة الإندوبلازمية Golgi (ERGIC) بينما يتم تجميع RNA (+ خيوط) مع بروتين N (nucleocapsid). ثم يرتبط معقد بروتين RNA هذا بالبروتين M المدمج في أغشية ER وتتشكل جزيئات الفيروس على شكل براعم معقدة nucleocapsid في ER. ينتقل الفيروس بعد ذلك عبر مجمع جولجي ويخرج في النهاية من الخلية ، على الأرجح عن طريق طرد الخلايا (B.N Fields et al. ، علم الفيروسات الحقول، ليبينكوت ويليامز وأمبير ويلكنز ، فيلادلفيا ، الطبعة الرابعة ، 2001). يقع موقع الارتباط الفيروسي بالخلية المضيفة داخل البروتين S.

تشمل فيروسات كورونا عددًا كبيرًا من الفيروسات التي تصيب أنواعًا مختلفة من الحيوانات. الأمراض السائدة المرتبطة بهذه الفيروسات هي التهابات الجهاز التنفسي والمعوية ، على الرغم من أن الأمراض الكبدية والعصبية تحدث أيضًا مع بعض الفيروسات. تنقسم فيروسات كورونا إلى ثلاثة أنماط مصلية ، الأنواع الأول والثاني والثالث. يحدد التحليل الوراثي لتسلسل الفيروس التاجي أيضًا ثلاث فئات رئيسية من هذه الفيروسات ، تتوافق مع كل من الأنماط المصلية الثلاثة. تحتوي فيروسات كورونا من النوع الثاني على جين إستراز هيماجلوتينين (HE) مماثل لجين فيروس الأنفلونزا سي. يُفترض أن مقدمة فيروسات كورونا من النوع الثاني اكتسبت HE نتيجة لحدث إعادة التركيب داخل خلية مضيفة مصابة بشكل مضاعف.

نظرًا للانتشار السريع لمرض السارس في جميع أنحاء العالم ، والذي لديه القدرة على إحداث جائحة ، إلى جانب معدلات المراضة والوفيات المقلقة ، سيكون من المفيد الحصول على فهم أفضل لعامل الفيروس التاجي هذا على المستوى الجزيئي لتوفير التشخيص واللقاحات ، والمداواة ، ودعم تدابير مراقبة الصحة العامة.

ملخص الاختراع

بشكل عام ، يوفر الاختراع التسلسل الجيني لفيروس كورونا جديد ، فيروس سارس ، ويوفر جزيئات حمض نووي جديدة تشفر بروتينات جديدة يمكن استخدامها ، على سبيل المثال ، لتشخيص أو علاج مجموعة متنوعة من الاضطرابات المرتبطة بفيروس السارس.

في أحد الجوانب ، يوفر الاختراع جزيء حمض نووي نقي لفيروس سارس أو جزء منه ، على سبيل المثال ، جزيء RNA أو DNA أو cDNA أو DNA اصطناعي أو mRNA. في بعض النماذج ، يشتمل جزيء الحمض النووي على تسلسل مطابق إلى حد كبير لأي من متواليات أرقام تعريف التسلسل: 1-13 ، 15-18 ، 20-30 ، 90-159 ، 208 ، 209. في بعض التجسيدات ، الحمض النووي يتضمن جزيء تسلسل من رقم معرف التسلسل: 1 أو رقم معرف التسلسل: 2 أو رقم معرف التسلسل: 15 أو جزء من هذه التسلسلات. في تجسيدات بديلة ، يمكن أن يشتمل جزيء الحمض النووي على تسلسل مطابق إلى حد كبير لمعرف التسلسل رقم: 1 أو رقم تعريف التسلسل: 2 أو رقم معرف التسلسل: 15 ، أو جزء منه في نماذج بديلة ، يمكن أن يشتمل جزيء الحمض النووي على s2m عزر (على سبيل المثال ، تسلسل s2m مطابق إلى حد كبير لأي من تسلسل أرقام معرف التسلسل: 16 و 17 و 18) ، تسلسل رئيسي (على سبيل المثال ، تسلسل مطابق إلى حد كبير لتسلسل معرف التسلسل رقم: 3) ، أو تسلسل تنظيمي نصي (على سبيل المثال ، تسلسل مطابق إلى حد كبير لأي من تسلسل أرقام معرف التسلسل: 4-13 و 20-30). في تجسيدات بديلة ، يشتمل جزيء الحمض النووي على تسلسل مطابق إلى حد كبير لأي من متواليات النيوكليوتيدات 265-13398 13398-21.485 21492-25259 25268-26.092 25.689-26153 26117-26347 26398-27.063 27.074-273273827 27،779-27،898 27،864-28،118 28،120-29،388 28،130-28،426 28،583-28،795 و 29،590-29،621 من رقم تعريف التسلسل: 15. في النماذج البديلة ، قد يشفر جزيء الحمض النووي متعدد البروتين أو بولي ببتيد. في نماذج بديلة ، يوفر الاختراع جزيء حمض نووي يشتمل على تسلسل مكمل لسلسلة نيوكليوتيدات فيروس SARS.

في جانب بديل ، يوفر الاختراع بولي ببتيد فيروس سارس نقيًا إلى حد كبير أو جزء منه ، على سبيل المثال ، متعدد البروتين ، بروتين سكري (على سبيل المثال ، بروتين سكري مصفوفة قد يتضمن تسلسلًا مطابقًا إلى حد كبير لتسلسل معرف التسلسل رقم: 34) ، بروتين عبر الغشاء (على سبيل المثال ، بروتين متعدد الغشاء ، أو بروتين عبر الغشاء من النوع الأول ، أو بروتين عبر الغشاء من النوع الثاني) ، أو بروتين رابط لـ RNA ، أو بروتين غلاف فيروسي. في تجسيدات بديلة ، يوفر الاختراع بروتين مكرر 1 أ ، بروتين مكرر 1 ب ، بروتين سكري مرتفع ، بروتين مغلف صغير ، بروتين سكري مصفوفة ، أو بروتين نيوكليوكابسيد. في نماذج بديلة ، يوفر الاختراع جزيء حمض نووي يشفر عديد ببتيد فيروس SARS. في التجسيدات البديلة ، يشتمل بولي ببتيد فيروسات السارس على تسلسل إشارة يمكن تحديده (على سبيل المثال ، تسلسل إشارة مطابق إلى حد كبير لتسلسل أرقام معرف التسلسل: 76 أو 85) ، مجال عبر الغشاء (على سبيل المثال ، مجال غشاء مطابق إلى حد كبير لأي من تسلسل أرقام معرف التسلسل: 77-86) ، مرساة عبر الغشاء ، حلزون عبر الغشاء ، مجال ربط ATP ، إشارة توطين نووية ، مجال محبة للماء ، (على سبيل المثال ، مجال محبة للماء متطابق إلى حد كبير مع تسلسل معرف التسلسل لا: 87) ، أو تسلسل غني باللايسين (على سبيل المثال ، تسلسل مطابق إلى حد كبير لتسلسل رقم معرف التسلسل: 14). في تجسيدات بديلة ، قد يشتمل عديد ببتيد فيروس السارس على تسلسل مطابق إلى حد كبير لأي من متواليات أرقام تعريف التسلسل: 14 ، 33-36 ، 64-74 ، 76-87.

في تجسيدات بديلة ، يوفر الاختراع ناقلًا (على سبيل المثال ، ناقل للعلاج الجيني أو ناقل الاستنساخ) بما في ذلك جزيء الحمض النووي لفيروس السارس (على سبيل المثال ، جزيء يتضمن تسلسلًا مطابقًا إلى حد كبير لأي من متواليات SEQ ID NO: 1-13 ، 15-18 ، 20-30 ، 90-159 ، 208 ، 209) ، أو خلية مضيفة (على سبيل المثال ، خلية ثديية ، أو خميرة ، أو بكتيريا ، أو خلية نيماتودا) بما في ذلك الناقل.

في نماذج بديلة ، يوفر الاختراع جزيء حمض نووي له هوية متوالية كبيرة من النيوكليوتيدات (على سبيل المثال ، 30٪ ، 40٪ ، 50٪ ، 60٪ ، 70٪ ، 80٪ ، 90٪ أو 100٪ تكامل) إلى تسلسل ترميز عديد ببتيد فيروس السارس أو جزء منه ، على سبيل المثال حيث يشتمل الجزء على ستة أحماض أمينية على الأقل ، وحيث يتم تهجين جزيء الحمض النووي تحت ظروف صرامة عالية إلى جزء على الأقل من جزيء الحمض النووي لفيروس السارس.

في نماذج بديلة ، يوفر الاختراع جزيء حمض نووي له هوية متوالية كبيرة من النيوكليوتيدات (على سبيل المثال ، 30٪ ، 40٪ ، 50٪ ، 60٪ ، 70٪ ، 80٪ ، 90٪ أو 100٪ تكامل) لنيوكليوتيدات فيروس سارس التسلسل ، على سبيل المثال حيث يشتمل جزيء الحمض النووي على عشرة نيوكليوتيدات على الأقل ، وحيث يتم تهجين جزيء الحمض النووي في ظل ظروف شديدة الصرامة إلى جزء على الأقل من جزيء الحمض النووي لفيروس سارس.

في تجسيدات بديلة ، يوفر الاختراع جزيء حمض نووي يشتمل على تسلسل مضاد لتفاعل جزيء الحمض النووي لفيروس سارس ، أو جسم مضاد (على سبيل المثال ، جسم مضاد معادل) يرتبط على وجه التحديد بعديد ببتيد لفيروس سارس.

في النماذج البديلة ، يوفر الاختراع طريقة لاكتشاف حاتمة سارس ، مثل فيريون أو عديد ببتيد في عينة ، عن طريق ملامسة العينة بجسم مضاد يرتبط على وجه التحديد بحلقة سارس ، مثل عديد ببتيد فيروسي ، وتحديد ما إذا كان الجسم المضاد يرتبط على وجه التحديد بالببتيد. في نماذج بديلة ، يوفر الاختراع طريقة لاكتشاف جينوم أو جين أو متماثل أو جزء منه لفيروس السارس في عينة عن طريق الاتصال بجزيء الحمض النووي لفيروس سارس ، على سبيل المثال حيث يشتمل جزيء الحمض النووي على عشرة نيوكليوتيدات على الأقل ، مع تحضير الحمض النووي الجيني من العينة ، في ظل ظروف التهجين التي توفر الكشف عن تسلسل الحمض النووي الذي يحتوي على هوية تسلسل النوكليوتيدات لجزيء الحمض النووي لفيروس سارس. في نماذج بديلة ، يوفر الاختراع طريقة لاستهداف بروتين للإفراز من خلية ، عن طريق ربط تسلسل إشارة من عديد ببتيد فيروس سارس بالبروتين ، بحيث يُفرز البروتين من الخلية.

في جوانب بديلة ، يوفر الاختراع طريقة لاستنباط استجابة مناعية في حيوان ، عن طريق تحديد حيوان مصاب أو معرض لخطر الإصابة بفيروس سارس وإعطاء عديد ببتيد فيروس سارس أو جزء منه أو جزء منه ، أو إعطاء سارس. جزيء الحمض النووي الفيروسي الذي يشفر عديد ببتيد فيروس السارس أو جزء منه للحيوان. في تجسيدات بديلة ، ينتج عن الإعطاء إنتاج جسم مضاد في الثدييات ، أو ينتج عنه تكوين الخلايا الليمفاوية التائية السامة للخلايا أو المساعدة في الثدييات.

في النماذج البديلة ، يوفر الاختراع مجموعة أدوات للكشف عن وجود جزيء الحمض النووي أو متعدد البيبتيد لفيروس سارس في عينة ، حيث تشتمل المجموعة على جزيء الحمض النووي لفيروس سارس ، أو جسم مضاد يرتبط على وجه التحديد ببولي ببتيد فيروس سارس.

في الجوانب البديلة ، يوفر الاختراع طريقة لعلاج أو الوقاية من عدوى فيروس السارس عن طريق تحديد حيوان (على سبيل المثال ، إنسان) مصاب أو معرض لخطر الإصابة بفيروس سارس ، وإعطاء جزيء الحمض النووي أو بولي ببتيد لفيروس السارس ، أو إعطاء مركب يثبط الإمراضية أو تكاثر فيروس السارس للحيوان. في نماذج بديلة ، يوفر الاختراع استخدام جزيء الحمض النووي أو متعدد البيبتيد لفيروس السارس لمعالجة أو منع عدوى فيروس السارس.

في الجوانب البديلة ، يوفر الاختراع طريقة لتحديد مركب لعلاج عدوى فيروس السارس أو الوقاية منه ، عن طريق الاتصال بعينة تشتمل على جزيء الحمض النووي لفيروس السارس أو الاتصال ببولي ببتيد فيروس سارس مع المركب ، حيث زيادة أو نقصان في التعبير أو يحدد نشاط جزيء الحمض النووي أو متعدد الببتيد مركبًا لعلاج أو منع عدوى فيروس السارس.

في الجوانب البديلة ، يوفر الاختراع لقاحًا (على سبيل المثال ، لقاح DNA) بما في ذلك جزيء الحمض النووي لفيروس السارس أو متعدد الببتيد.

في جوانب بديلة ، يوفر الاختراع مصفحًا دقيقًا يشتمل على مجموعة من العناصر ، حيث يشتمل كل عنصر على واحد أو أكثر من متواليات الحمض النووي أو الأحماض الأمينية المتميزة ، وحيث يتم اختيار التسلسلات من جزيء الحمض النووي لفيروس سارس أو عديد ببتيد ، أو جسم مضاد على وجه التحديد يربط جزيء الحمض النووي لفيروس سارس أو عديد ببتيد.

في جوانب بديلة ، يوفر الاختراع سجلاً قابلاً للقراءة على الكمبيوتر (على سبيل المثال ، قاعدة بيانات) بما في ذلك الحمض النووي المتميز لفيروس السارس أو متواليات الأحماض الأمينية.

"فيروس السارس" هو فيروس ينتمي إلى عائلة الفيروس التاجي ويُعرف بأنه العامل المسبب لمتلازمة الجهاز التنفسي الحادة المفاجئة (سارس). يمكن أن يشتمل جزيء الحمض النووي لفيروس السارس على تسلسل مطابق إلى حد كبير لمتواليات النيوكليوتيدات الموصوفة هنا أو أجزاء منها. قد يشتمل عديد ببتيد فيروسات السارس على تسلسل مطابق إلى حد كبير لتسلسل مشفر بواسطة جزيء الحمض النووي لفيروس السارس ، أو قد يشتمل على تسلسل مطابق إلى حد كبير لمتواليات عديد الببتيد الموصوفة هنا ، أو أجزاء منها.

يكون المركب "نقيًا إلى حد كبير" عند فصله عن المكونات المصاحبة له بشكل طبيعي. عادة ، يكون المركب نقيًا إلى حد كبير عندما يكون على الأقل 60٪ ، وبشكل عام 75٪ أو أكثر من 90٪ ، بالوزن ، من إجمالي المادة في العينة. وهكذا ، على سبيل المثال ، فإن البولي ببتيد الذي يتم تصنيعه كيميائيًا أو يتم إنتاجه بواسطة تقنية إعادة الارتباط سيكون بشكل عام خاليًا بشكل كبير من المكونات المرتبطة به بشكل طبيعي. قد يكون جزيء الحمض النووي نقيًا إلى حد كبير عندما لا يكون قريبًا على الفور (أي مرتبط تساهميًا) مع متواليات التشفير التي يكون متجاورًا معها في الجينوم الطبيعي للكائن الذي تم اشتقاق DNA الخاص بالاختراع منه. قد يكون جزيء الحمض النووي أيضًا نقيًا إلى حد كبير عند عزله عن الكائن الحي الذي يوجد فيه بشكل طبيعي. يمكن الحصول على مركب نقي إلى حد كبير ، على سبيل المثال ، عن طريق الاستخراج من مصدر طبيعي بالتعبير عن جزيء حمض نووي مؤتلف يشفر مركب متعدد الببتيد أو عن طريق التخليق الكيميائي. يمكن قياس النقاء باستخدام أي طريقة مناسبة مثل كروماتوغرافيا العمود ، الرحلان الكهربائي للهلام ، HPLC ، إلخ.

التسلسل "المتطابق إلى حد كبير" هو تسلسل حمض أميني أو نيوكليوتيد يختلف عن تسلسل مرجعي فقط من خلال واحد أو أكثر من البدائل المحافظة ، كما تمت مناقشته هنا ، أو عن طريق واحد أو أكثر من البدائل غير المحافظة ، أو الحذف ، أو الإدخالات الموجودة في مواضع تسلسل لا يدمر الوظيفة البيولوجية للحمض الأميني أو جزيء الحمض النووي. يمكن أن يكون هذا التسلسل 10٪ أو 20٪ أو 30٪ أو 40٪ أو 50٪ أو 52.5٪ أو 55٪ أو 60٪ أو 75٪ على الأقل ، أو بشكل أكثر عمومية 80٪ أو 85٪ أو 90٪ أو 95 النسبة المئوية أو ما يصل إلى 99٪ أو 100٪ متطابقة على مستوى الأحماض الأمينية أو النيوكليوتيدات مع التسلسل المستخدم للمقارنة باستخدام ، على سبيل المثال ، Align Program (Myers and Miller، CABIOS، 1989، 4: 11-17) أو FASTA . بالنسبة لعديد الببتيدات ، قد لا يقل طول متواليات المقارنة عن 4 أو 5 أو 10 أو 15 من الأحماض الأمينية أو 20 أو 25 أو 30 حمضًا أمينيًا على الأقل. في نماذج بديلة ، قد يكون طول متواليات المقارنة على الأقل 35 أو 40 أو 50 حمض أميني أو أكثر من 60 أو 80 أو 100 حمض أميني. بالنسبة لجزيئات الحمض النووي ، قد يكون طول متواليات المقارنة 15 أو 20 أو 25 نيوكليوتيدًا على الأقل ، أو 30 أو 40 أو 50 نيوكليوتيدًا على الأقل. في نماذج بديلة ، قد يكون طول متواليات المقارنة على الأقل 60 أو 70 أو 80 أو 90 نيوكليوتيد أو أكثر من 100 أو 200 أو 500 نيوكليوتيد. يمكن قياس هوية التسلسل بسهولة باستخدام برنامج تحليل التسلسل المتاح للجمهور (على سبيل المثال ، حزمة برامج تحليل التسلسل من Genetics Computer Group ، أو مركز التكنولوجيا الحيوية بجامعة ويسكونسن ، أو 1710 University Avenue ، Madison ، Wis.53705 ، أو برنامج BLAST المتاح من المكتبة الوطنية لـ الطب ، أو كما هو موصوف هنا). تتضمن أمثلة البرامج المفيدة البرامج Pile-up و PrettyBox. تطابق هذه البرامج تسلسلات متشابهة عن طريق تعيين درجات التناظر إلى عمليات الاستبدال والحذف والإدخال والتعديلات الأخرى.

بشكل بديل ، أو بالإضافة إلى ذلك ، قد يكون تسلسلان من الحمض النووي "متطابقين إلى حد كبير" إذا تم تهجينهما تحت ظروف صرامة عالية. في بعض النماذج ، تكون شروط الصرامة العالية ، على سبيل المثال ، ظروف تسمح بتهجين مماثل للتهجين الذي يحدث باستخدام مسبار DNA لا يقل طوله عن 500 نيوكليوتيد ، في مخزن مؤقت يحتوي على 0.5 M NaHPO4، ودرجة الحموضة 7.2 ، و 7٪ SDS ، و 1 مم EDTA ، و 1٪ BSA (جزء V) ، عند درجة حرارة 65 درجة مئوية ، أو مخزن مؤقت يحتوي على 48٪ فورماميد ، 4.8 × SSC ، 0.2 M Tris-Cl ، pH 7.6 ، 1 × محلول Denhardt ، 10٪ ديكستران كبريتات ، و 0.1٪ SDS ، عند درجة حرارة 42 درجة مئوية (هذه ظروف نموذجية للتهجين الشمالي أو الجنوبي شديد الصرامة.) يمكن إجراء التهجين على مدى فترة من حوالي 20 إلى 30 دقيقة ، أو حوالي 2 إلى 6 ساعات ، أو حوالي 10 إلى 15 ساعة ، أو أكثر من 24 ساعة. يتم أيضًا الاعتماد على التهجين عالي الصرامة لنجاح العديد من التقنيات التي يتم إجراؤها بشكل روتيني بواسطة علماء الأحياء الجزيئية ، مثل PCR عالي الصرامة ، وتسلسل الحمض النووي ، وتحليل تعدد الأشكال المطابق لشريط واحد ، والتهجين في الموقع. على النقيض من عمليات التهجين الشمالية والجنوبية ، يتم تنفيذ هذه التقنيات عادةً باستخدام مجسات قصيرة نسبيًا (على سبيل المثال ، عادةً حوالي 16 نيوكليوتيد أو أطول من أجل PCR أو التسلسل وحوالي 40 نيوكليوتيد أو أطول للتهجين في الموقع). شروط الصرامة العالية المستخدمة في هذه التقنيات معروفة جيدًا لأولئك المهرة في فن البيولوجيا الجزيئية ، ويمكن العثور على أمثلة عليها ، على سبيل المثال ، في Ausubel وآخرون ، البروتوكولات الحالية في البيولوجيا الجزيئية ، John Wiley & amp Sons ، New يورك ، نيويورك ، 1998 ، والتي أدرجت بموجب هذا بالإشارة.

تشمل المصطلحات "حمض نووي" أو "جزيء حمض نووي" كلا من RNA (خيوط موجبة وناقص) و DNA ، بما في ذلك cDNA ، DNA الجينومي ، والحمض النووي الاصطناعي (على سبيل المثال ، المركب كيميائيًا). قد يكون الحمض النووي مزدوج الخيط أو أحادي السلسلة. عندما يكون الحمض النووي منفردًا تقطعت به السبل ، فقد يكون خيط الإحساس أو الخيط المضاد. قد يكون جزيء الحمض النووي أي سلسلة من اثنين أو أكثر من النيوكليوتيدات المرتبطة تساهميًا ، بما في ذلك النيوكليوتيدات التي تحدث بشكل طبيعي أو التي تحدث بشكل غير طبيعي ، أو نظائر أو مشتقات النوكليوتيدات. يُقصد بـ "RNA" سلسلة من اثنين أو أكثر من الترابط التساهمي ، يحدث بشكل طبيعي أو يتم تعديل الريبونوكليوتيدات. أحد الأمثلة على الحمض النووي الريبي المعدل المتضمن في هذا المصطلح هو حمض الفوسفوروثيوات RNA. يقصد بعبارة "DNA" سلسلة من اثنين أو أكثر من الترابط التساهمي ، والتي تحدث بشكل طبيعي أو المعدلة deoxyribonucleotides. يُقصد بعبارة "cDNA" الحمض النووي التكميلي أو نسخه الناتج من قالب RNA عن طريق عمل بوليميريز الحمض النووي المعتمد على الحمض النووي الريبي (النسخ العكسي). وبالتالي ، فإن "استنساخ cDNA" يعني تسلسل DNA مزدوج الاتجاه مكمل لجزيء RNA ذي أهمية ، ويتم حمله في ناقل استنساخ.

"الحمض النووي المعزول" هو جزيء حمض نووي خالٍ من جزيئات الحمض النووي التي تحيط به عادةً في الجينوم أو يكون خاليًا من الكائن الحي الذي يوجد فيه عادةً. لذلك ، يُقصد بالجين "المعزول" أو جزيء الحمض النووي في بعض الحالات الجين أو جزيء الحمض النووي غير المحاط بجزيئات الحمض النووي التي عادةً (في الطبيعة) تحيط بالجين أو جزيء الحمض النووي (كما هو الحال في الجينوم). متواليات) و / أو تمت تنقيته كليًا أو جزئيًا من التسلسلات المنسوخة الأخرى (كما في مكتبة cDNA أو RNA). في بعض الحالات ، يُقصد بجزيء الحمض النووي المعزول جينوم كائن حي مثل الفيروس. يمكن عزل حمض نووي معزول وفقًا للاختراع إلى حد كبير فيما يتعلق بالبيئة الخلوية المعقدة التي يحدث فيها بشكل طبيعي. في بعض الحالات ، ستشكل المادة المعزولة جزءًا من تركيبة (على سبيل المثال ، مستخلص خام يحتوي على مواد أخرى) ، نظام عازل أو خليط كاشف. في ظروف أخرى ، يمكن تنقية المادة إلى التجانس الأساسي ، على سبيل المثال كما هو محدد بواسطة PAGE أو العمود اللوني مثل HPLC. وبالتالي ، فإن المصطلح يشمل ، على سبيل المثال ، الجينوم وهو حمض نووي مؤتلف مدمج في ناقل ، مثل البلازميد أو الفيروس المتكاثر ذاتيًا أو في الحمض النووي الجيني لدائيات النوى أو حقيقيات النوى ، أو الموجود كجزيء منفصل (على سبيل المثال ، cDNA أو جزء من الحمض النووي الجيني الناتج عن تفاعل البوليميراز المتسلسل أو علاج نوكلياز تقييدية) مستقلة عن التسلسلات الأخرى. كما يتضمن أيضًا حمضًا نوويًا مؤتلفًا وهو جزء من جين هجين يشفر متواليات بولي ببتيد إضافية. على نحو مفضل ، يشتمل الحمض النووي المعزول على الأقل على حوالي 50 أو 80 أو 90 في المائة (على أساس مولاري) من جميع أنواع الجزيئات الكبيرة الموجودة. وهكذا ، يمكن أن يشتمل الجين المعزول أو جزيء الحمض النووي على جين أو جزيء حمض نووي يتم تصنيعه كيميائيًا أو بوسائل معاد الارتباط. يتم تضمين الحمض النووي المؤتلف الموجود في ناقل في تعريف "المعزول" كما هو مستخدم هنا. أيضًا ، تشتمل جزيئات الحمض النووي المعزولة على جزيئات DNA المؤتلفة في الخلايا المضيفة غير المتجانسة ، بالإضافة إلى جزيئات DNA المنقاة جزئيًا أو جوهريًا في المحلول. في الجسم الحي وفي المختبر ، يتم أيضًا تضمين نسخ RNA لجزيئات DNA للاختراع الحالي بواسطة جزيئات الحمض النووي "المعزولة". هذه الجزيئات المعزولة من الحمض النووي مفيدة في تصنيع البولي ببتيد المشفر ، مثل مجسات لعزل المتواليات المتماثلة (على سبيل المثال ، من الأنواع الأخرى) ، لرسم خرائط الجينات (على سبيل المثال ، عن طريق التهجين في الموقع مع الكروموسومات) ، أو للكشف عن التعبير عن النواة. جزيء الحمض في الأنسجة (على سبيل المثال ، الأنسجة البشرية ، مثل الدم المحيطي) ، مثل تحليل اللطخة الشمالية.

قد تكون متواليات الجينات والحمض النووي المختلفة للاختراع مترابطة. يعني المصطلح "المؤتلف" أن شيئًا ما قد تم إعادة تجميعه ، بحيث عند الإشارة إلى بناء حمض نووي ، يشير المصطلح إلى جزيء يتكون من متواليات الحمض النووي التي يتم ربطها معًا أو إنتاجها عن طريق التقنيات البيولوجية الجزيئية. يشير المصطلح "مؤتلف" عندما يشير إلى بروتين أو بولي ببتيد إلى جزيء بروتين أو متعدد الببتيد يتم التعبير عنه باستخدام بنية حمض نووي مؤتلف تم إنشاؤه عن طريق التقنيات البيولوجية الجزيئية. يشير مصطلح "المؤتلف" عند الإشارة إلى التركيب الجيني إلى الأمشاج أو السلالة مع توليفات جديدة من الأليلات التي لم تحدث في جينومات الوالدين. قد تشتمل تركيبات الحمض النووي المؤتلف على تسلسل نيوكليوتيد مرتبط أو يتم التلاعب به ليصبح مرتبطًا بتسلسل حمض نووي لا يرتبط به بطبيعته أو يرتبط به في موقع مختلف في الطبيعة. إن الإشارة إلى بناء الحمض النووي على أنه "مؤتلف" يشير بالتالي إلى أن جزيء الحمض النووي قد تم التلاعب به باستخدام الهندسة الوراثية ، أي عن طريق التدخل البشري. يمكن على سبيل المثال إدخال بنيات الحمض النووي المؤتلف في خلية مضيفة عن طريق التحويل. قد تشتمل تركيبات الحمض النووي المؤتلف هذه على متواليات مشتقة من نفس أنواع الخلايا المضيفة أو من أنواع مختلفة من الخلايا المضيفة ، والتي تم عزلها وإعادة إدخالها في خلايا الأنواع المضيفة. قد يتم دمج تسلسلات بناء الحمض النووي المؤتلف في جينوم الخلية المضيفة ، إما نتيجة للتحول الأصلي للخلايا المضيفة ، أو نتيجة إعادة التركيب اللاحقة و / أو أحداث الإصلاح.

كما هو مستخدم هنا ، "غير المتجانسة" في إشارة إلى حمض نووي أو بروتين هو جزيء تم التلاعب به بواسطة تدخل بشري بحيث يكون موجودًا في مكان آخر غير المكان الذي يوجد فيه بشكل طبيعي. على سبيل المثال ، قد يتم إدخال تسلسل الحمض النووي من نوع واحد في جينوم نوع آخر ، أو قد يتم نقل تسلسل الحمض النووي من موضع جينومي إلى موضع جينومي أو خارج الصبغي في نفس النوع. يتضمن البروتين غير المتجانسة ، على سبيل المثال ، بروتينًا يتم التعبير عنه من تسلسل تشفير غير متجانس أو بروتين يتم التعبير عنه من جين مؤتلف في خلية لا تعبر عن البروتين بشكل طبيعي.

بواسطة "مضاد المعنى" ، كما هو مستخدم هنا بالإشارة إلى الأحماض النووية ، يُقصد به تسلسل الحمض النووي الذي يكون مكملاً لخيط واحد من جزيء الحمض النووي. في بعض النماذج ، يكون تسلسل مضاد المعنى مكملًا لخيط تشفير الجين ، ويفضل أن يكون جين فيروس سارس. جزيء الحمض النووي المفضل المضاد للترتيب هو الذي يمكنه خفض مستوى عديد الببتيد المشفر بواسطة الجين التكميلي عندما يتم التعبير عن كليهما في خلية. في بعض النماذج ، ينخفض ​​مستوى البولي ببتيد بنسبة 10٪ على الأقل ، أو 25٪ على الأقل ، أو 50٪ على الأقل ، مقارنة بمستوى متعدد البيبتيد في خلية تعبر عن الجين فقط ، وليس جزيء الحمض النووي المضاد التكميلي.

"المسبار" أو "التمهيدي" عبارة عن جزيء DNA أو RNA أحادي الجديلة من تسلسل محدد يمكن أن يقترن بجزيء DNA أو RNA ثان يحتوي على تسلسل تكميلي (الهدف). يعتمد استقرار الجزيء الهجين الناتج على مدى الاقتران الأساسي الذي يحدث ، ويتأثر بمعلمات مثل درجة التكامل بين المسبار والجزيء المستهدف ، ودرجة صرامة شروط التهجين. تتأثر درجة صرامة التهجين بمعلمات مثل درجة الحرارة وتركيز الملح وتركيز الجزيئات العضوية ، مثل فورماميد ، ويتم تحديدها بواسطة طرق معروفة لأولئك المهرة في المجال. قد تختلف المجسات أو البادئات الخاصة بتسلسل أو جزيئات الحمض النووي لفيروس السارس في الطول من 8 نيوكليوتيدات على الأقل إلى أكثر من 500 نيوكليوتيد ، بما في ذلك أي قيمة بينهما ، اعتمادًا على الغرض والظروف التي يتم فيها استخدام المسبار أو التمهيدي . على سبيل المثال ، قد يكون المسبار أو التمهيدي بطول 8 أو 10 أو 15 أو 20 أو 25 نيوكليوتيدًا ، أو قد يكون على الأقل 30 أو 40 أو 50 أو 60 نيوكليوتيدًا في الطول ، أو ربما يزيد عن 100 أو 200 أو 500 أو 1000 نيوكليوتيد في الطول. قد تحتوي المجسات أو البادئات الخاصة بجزيئات الحمض النووي لفيروس السارس على هوية تسلسل أكبر من 20-30٪ ، أو على الأقل 55-75٪ هوية تسلسل ، أو 75-85٪ على الأقل تسلسل هوية ، أو 85-99٪ على الأقل هوية تسلسل ، أو هوية متوالية 100٪ لتتابعات الحمض النووي الموصوفة هنا. في تجسيدات مختلفة للاختراع ، تحقيقات لها التسلسلات: 5′-ATg AAT TAC CAA gTC AAT ggT TAC-3 ، رقم معرف التسلسل: 160 5′-gAA gCT ATT CgT CAC gTT Cg-3 ، رقم معرف التسلسل: 161 5′-CTg TAg AAA ATC CTA gCT ggA g-3 ، رقم معرف التسلسل: 162 5′-CAT AAC CAg TCg gTA CAg CTA-3 ′ ، رقم معرف التسلسل: 163 5′-TTA TCA CCC gCgAg AAg CT- 3 ′ ، رقم معرف التسلسل: 164 5′-CTC TAg TTg CATGAC AgC CCT C-3 ′ ، رقم معرف التسلسل: 165 5′-TCg TgC gTg gAT TggCTT TgA TgT-3 ′ ، رقم معرف التسلسل: 166 5′-ggg TTg ggA CTA TCC TAA gTg TgA-3 ′ ، رقم معرف التسلسل: 167 5′-TAA CAC ACA AAC ACC ATC ATC A-3 ′ ، رقم معرف التسلسل: 168 5′-ggT Tgg gAC TAT CCT AAg TgT gA-3 ′ ، رقم معرف التسلسل: 169 5′-CCA TCA TCA gAT AgA ATC ATC ATA-3 ، رقم معرف التسلسل: 170 5′-CCT CTC TTg TTC TTg CTC gCA-3 ′ ، رقم معرف التسلسل: 171 5′-TAT AgT gAg CCg CCA CAC Atg-3 ، رقم معرف التسلسل: 172 5′-TAACACACAACICCATCATCA-3 ′ ، رقم معرف التسلسل: 173 5′-CTAACATGCTTAGGATAATGG-3 ′ ، رقم معرف التسلسل: 174 5′-GCCTCTTGTTCTTGCTCGQ-ID رقم: 175 5′-CAGGTAAGCGTAAAACTCATC-3 ، رقم معرف التسلسل: 176 5′-TACACACCTCAGCGTTG-3 ′ ، رقم معرف التسلسل: 177 5′-CACGAACGTGACGAAT-3 ، رقم معرف التسلسل: 178 5′-GC CGGAGCTCTGCAGAATTC-3 ، رقم معرف التسلسل: 179 5′-CAGGAAACAGCTATGAC TTGCATCACCACTAGTTGTGCCACCAGGTT-3 ، رقم معرّف التسلسل: 180 5′-TGTAAAACGACGGCCAGTAGTGATGGGATGTGTQTGA ، بالإضافة إلى التسلسلات التي يتم تضخيمها بواسطة توليفات محددة من هذه المسابير ، يمكن استبعادها من استخدامات محددة وفقًا للاختراع. يمكن تمييز المجسات بشكل يمكن اكتشافه ، إما بشكل إشعاعي أو غير إشعاعي ، من خلال طرق معروفة لأولئك المهرة في المجال. يمكن استخدام المجسات للطرق التي تتضمن تهجين الحمض النووي ، مثل تسلسل الحمض النووي ، وتضخيم الحمض النووي عن طريق تفاعل البوليميراز المتسلسل ، وتحليل تعدد الأشكال المطابق الذي تقطعت به السبل (SSCP) ، وتحليل تعدد الأشكال المقيد (RFLP) ، والتهجين الجنوبي ، والتهجين الشمالي ، في التهجين الموضعي ، ومقايسة تحول الحركة الكهربي (EMSA) ، والطرق الأخرى المعروفة لأولئك المهرة في المجال.

يقصد بكلمة "مكمل" أن جزيئين من الحمض النووي ، على سبيل المثال ، DNA أو RNA ، يحتويان على عدد كافٍ من النيوكليوتيدات القادرة على تكوين أزواج قاعدة Watson-Crick لإنتاج منطقة تقطعت بها السبل المزدوجة بين اثنين من الأحماض النووية. وهكذا ، يتزاوج الأدينين في خيط واحد من DNA أو RNA مع الثايمين في خيط DNA تكميلي متعارض أو مع uracil في خيط RNA تكميلي متعارض. سيكون من المفهوم أن كل نيوكليوتيد في جزيء الحمض النووي لا يحتاج إلى تكوين زوج قاعدة Watson-Crick متطابق مع نيوكليوتيد في حبلا تكميلي معاكس لتشكيل مزدوج.

يُقصد بكلمة "ناقل" جزيء DNA مشتق ، على سبيل المثال ، من بلازميد ، أو عاثية ، أو فيروس ثديي أو حشرات ، أو كروموسوم صناعي ، يمكن استخدامه لإدخال عديد ببتيد ، على سبيل المثال عديد ببتيد فيروس سارس ، إلى خلية مضيفة بواسطة وسيلة لتكرار أو التعبير عن جزيء حمض نووي غير متجانس مرتبط عمليًا. يُقصد بعبارة "مرتبط بشكل عملي" أن جزيء الحمض النووي مثل الجين وواحد أو أكثر من التسلسلات التنظيمية (على سبيل المثال ، المحفزات ومواقع الارتباط الريبوزومي والمُحَسِّنات في معززات بدائيات النوى والمُنهي والمعززات في متواليات زعيم حقيقيات النوى ، إلخ) متصلة في مثل هذه الطريقة للسماح بالوظيفة المطلوبة على سبيل المثال التعبير الجيني عندما ترتبط الجزيئات المناسبة (على سبيل المثال ، بروتينات المنشط النسخي) بالتسلسلات التنظيمية.قد يحتوي المتجه على واحد أو أكثر من مواقع التقييد الفريدة وقد يكون قادرًا على التكرار المستقل في مضيف محدد أو كائن حي للسيارة بحيث يكون التسلسل المستنسخ قابلاً للتكاثر. يُقصد بـ "ناقل تعبير الحمض النووي" أي عنصر مستقل قادر على توجيه توليف الببتيد المؤتلف. تشتمل نواقل التعبير عن الحمض النووي على البلازميدات والعاقمات الجرثومية والثدييات والبلازميدات والفيروسات. يُفهم "ناقل المكوك" على أنه يعني ناقل يمكن نشره في نوعين مختلفين من الخلايا على الأقل ، أو كائنات حية ، على سبيل المثال النواقل التي يتم نشرها أولاً أو تكرارها في بدائيات النوى من أجل ، على سبيل المثال ، انتقال العدوى إلى خلايا حقيقية النواة. "النسخ المتماثل" هو وحدة قادرة على التكاثر المستقل في الخلية وقد تشتمل على البلازميدات والكروموسومات (مثل الكروموسومات الصغيرة) والكونيات والفيروسات وما إلى ذلك.

"الخلية المضيفة" هي أي خلية ، بما في ذلك خلية بدائية النواة أو حقيقية النواة ، تم إدخال نسخة منها ، مثل ناقل ، عن طريق التحويل أو تعداء أو عدوى على سبيل المثال.

"إطار القراءة المفتوح" أو "ORF" هو تسلسل الحمض النووي الذي يشفر بولي ببتيد. قد يشتمل ORF على تسلسل تشفير له أي تسلسل يمكن نسخه إلى mRNA و / أو ترجمته إلى بروتين عند دمجه مع التسلسلات التنظيمية المناسبة. بشكل عام ، يشتمل تسلسل الترميز على كودون لبدء الترجمة 5 وكودون إيقاف ترجمة 3.

"التسلسل الرئيسي" هو تسلسل نيوكليوتيد قصير نسبيًا يقع في نهاية 5 من جزيء RNA الذي يعمل كأساس للنسخ.

"التسلسل التنظيمي النسخي" "TRS" أو "التسلسل بين الجينات" هو تسلسل نيوكليوتيد يقع في أعلى مجرى إطار القراءة المفتوح (ORF) ويعمل كقالب لإعادة تجميع مركب RNA وليميراز ناشئ.

تحدث "طفرة انزياح الإطار" عن طريق التحول في إطار قراءة مفتوح ، ويرجع ذلك عمومًا إلى حذف أو إضافة نيوكليوتيد واحد على الأقل ، بحيث يتم في النهاية ترجمة عديد ببتيد بديل.

يقصد بعبارة "الموسومة بشكل قابل للكشف" أي وسيلة لتمييز وتحديد وجود جزيء ، على سبيل المثال ، مسبار قليل النوكليوتيد أو مادة أولية ، أو جين أو جزء منه ، أو جزيء cDNA ، أو عديد ببتيد ، أو جسم مضاد. طرق تمييز الجزيء بشكل يمكن اكتشافه معروفة جيدًا في المجال وتشمل ، على سبيل المثال لا الحصر ، وضع العلامات المشعة (على سبيل المثال ، مع نظير مثل 32 P أو 35 S) ووضع العلامات غير المشعة مثل الوسم الأنزيمي (على سبيل المثال ، استخدام بيروكسيداز الفجل أو الفوسفاتاز القلوي) ، أو وضع العلامات المضيئة كيميائيًا ، أو وضع العلامات الفلورية (على سبيل المثال ، استخدام الفلورسين) ، أو وضع العلامات الحيوية ، أو الكشف عن الأجسام المضادة للروابط المرتبطة بالمسبار ، أو الكشف عن الحمض النووي مزدوج الشريطة. يشتمل هذا التعريف أيضًا على جزيء يتم تمييزه بشكل يمكن اكتشافه بوسائل غير مباشرة ، على سبيل المثال ، جزيء مرتبط بجزء أول (مثل البيوتين) والذي بدوره يرتبط بجزء ثان يمكن ملاحظته أو يعاير (مثل ستربتافيدين المسمى فلوريسئين). تشمل الملصقات أيضًا الديجوكسيجينين والوسيفيراز والإيكورين.

"الببتيد" أو "البروتين" أو "البروتين المتعدد" أو "متعدد الببتيد" هو أي سلسلة من اثنين أو أكثر من الأحماض الأمينية ، بما في ذلك الأحماض الأمينية الموجودة بشكل طبيعي أو التي تحدث بشكل غير طبيعي أو نظائرها من الأحماض الأمينية ، بغض النظر عن التعديل اللاحق للترجمة (على سبيل المثال ، الارتباط بالجليكوزيل أو الفسفرة). قد يشتمل "متعدد البروتين" أو "متعدد الببتيد" أو "ببتيد" أو "بروتين" للاختراع على ببتيدات أو بروتينات لها روابط غير طبيعية أو روابط متقاطعة وأغطية نهاية أو روابط غير ببتيدية أو مجموعات تعديل بديلة. تكون هذه الببتيدات المعدلة أيضًا ضمن نطاق الاختراع. يُقصد بمصطلح "مجموعة التعديل" أن يشمل الهياكل المرتبطة مباشرة بالبنية الببتيدية (على سبيل المثال ، عن طريق الاقتران التساهمي) ، بالإضافة إلى تلك التي ترتبط بشكل غير مباشر بالبنية الببتيدية (على سبيل المثال ، من خلال ارتباط ثابت غير تساهمي أو عن طريق الاقتران التساهمي بمخلفات الأحماض الأمينية الإضافية ، أو تقليدها ، أو نظائرها أو مشتقاتها ، والتي قد تحيط بالبنية الببتيدية الأساسية). على سبيل المثال ، يمكن أن تقترن المجموعة المعدلة بالنهاية الأمينية أو الطرف الكربوكسي للبنية الببتيدية ، أو إلى منطقة ببتيدية أو محاكية للببتيد التي تحوي المجال الأساسي. بدلاً من ذلك ، يمكن أن تقترن مجموعة التعديل بسلسلة جانبية من بقايا حمض أميني واحد على الأقل من بنية ببتيدية ، أو منطقة ببتيدية أو ببتيدو مقلدة تحيط بالمجال الأساسي (على سبيل المثال ، من خلال مجموعة إبسيلون أمينية لبقايا ليسيل ( ق) ، من خلال مجموعة الكربوكسيل لبقايا (رواسب) حمض الأسبارتيك أو بقايا (بقايا) حمض الغلوتاميك ، من خلال مجموعة هيدروكسي من بقايا (بقايا) التيروزيل ، أو بقايا (رواسب) سيرين أو بقايا (رواسب) ثريونين أو مجموعة تفاعلية مناسبة أخرى على سلسلة جانبية من الأحماض الأمينية). يمكن ربط المجموعات المعدلة المقترنة تساهميًا بالبنية الببتيدية بوسائل وباستخدام طرق معروفة جيدًا في الفن لربط الهياكل الكيميائية ، بما في ذلك ، على سبيل المثال ، روابط الأميد أو الألكيلامين أو الكاربامات أو اليوريا.

"البروتين المتعدد" هو عديد الببتيد الذي يتم ترجمته مبدئيًا من جينوم فيروس RNA زائد تقطعت بهم السبل ، على سبيل المثال ، فيروس سارس. وفقًا لذلك ، لم يخضع البروتين المتعدد للمعالجة اللاحقة عن طريق الانقسام المحلل للبروتين في منتجاته البروتينية المصنعة ، وبالتالي يحتفظ بمواقع الانقسام. في بعض تجسيدات الاختراع ، يمكن تعديل مواقع انقسام البروتياز لبولي بروتين ، على سبيل المثال ، باستبدال الأحماض الأمينية ، لينتج عنها بروتين متعدد غير قادر على الانقسام في منتجاته البروتينية المعالجة.

الجسم المضاد "يربط على وجه التحديد" أو "يرتبط بشكل انتقائي" بمولد الضد عندما يتعرف على مولد الضد ويربطه ، ولكنه لا يتعرف إلى حد كبير ويربط الجزيئات الأخرى في عينة ، على سبيل المثال تقارب لمولد الضد هو 10 ، 100 ، 1000 أو 10000 مرة أكبر من ألفة الجسم المضاد لجزيء مرجعي آخر في عينة. "الجسم المضاد المعادل" هو جسم مضاد يتداخل بشكل انتقائي مع أي من الأنشطة البيولوجية لعديد ببتيد فيروس سارس أو متعدد البروتينات ، على سبيل المثال ، تكرار فيروس السارس ، أو إصابة الخلايا المضيفة. قد يقلل الجسم المضاد المعادل من قدرة عديد ببتيد فيروس السارس على القيام بنشاطه البيولوجي المحدد بحوالي 50٪ ، أو بحوالي 70٪ ، أو بحوالي 90٪ أو أكثر ، أو قد يلغي تمامًا قدرة عديد ببتيد فيروس السارس على القيام بنشاطها البيولوجي المحدد. قد تكون أي مقايسة قياسية للنشاط البيولوجي لأي عديد ببتيد لفيروس سارس ، على سبيل المثال ، فحوصات تحديد مستويات التعبير ، والقدرة على إصابة الخلايا المضيفة ، أو القدرة على تكرار الحمض النووي ، بما في ذلك تلك المقايسات الموصوفة هنا أو المعروفة لمن يتمتعون بالمهارة في المجال. تستخدم لتقييم الأجسام المضادة التي يحتمل تحييدها والتي تكون محددة لعديد ببتيدات فيروس السارس.

"تسلسل الإشارة" هو سلسلة من الأحماض الأمينية التي يمكن تحديدها ، على سبيل المثال عن طريق التماثل أو النشاط البيولوجي لتسلسل الببتيد مع الوظيفة المعروفة لاستهداف عديد ببتيد إلى منطقة معينة من الخلية. قد يكون تسلسل الإشارة أو إشارة الببتيد عبارة عن ببتيد من أي طول ، يكون قادرًا على استهداف عديد ببتيد إلى منطقة معينة من الخلية. في بعض النماذج ، قد يوجه تسلسل الإشارة متعدد الببتيد إلى الغشاء الخلوي بحيث يمكن إفراز البولي ببتيد. في تجسيدات بديلة ، قد يوجه تسلسل الإشارة البولي ببتيد إلى حجرة أو عضية داخل الخلية ، مثل جهاز جولجي ، أو إلى سطح فيروس ، مثل فيروس سارس. في نماذج بديلة ، قد يتراوح طول تسلسل الإشارة من حوالي 13 أو 15 حمضًا أمينيًا في الطول إلى حوالي 60 حمضًا أمينيًا في الطول.

"بروتين الغشاء" هو بروتين أمفيباثيك له منطقة كارهة للماء ("مجال الغشاء") الذي يمتد الطبقة الدهنية الثنائية لغشاء الخلية من السيتوبلازم إلى سطح الخلية ، أو يمتد على الغلاف الفيروسي ، ويتخللها مناطق محبة للماء على جانبي الغشاء. غالبًا ما يتناسب عدد المناطق الكارهة للماء في بروتين أمفيباثي مع عدد المرات التي تمتد فيها البروتينات في طبقة الدهون الثنائية. وهكذا ، يمتد بروتين عبر الغشاء الفردي عبر طبقة ثنائية الدهون مرة واحدة ، وله مجال غشاء واحد ، بينما يمتد البروتين متعدد الغشاء عبر طبقة ثنائية الدهون عدة مرات. قد تمكن البروتينات متعددة الأغشية من دخول الفيروس إلى خلية مضيفة ، أو تعمل على بدء نقل إشارة من سطح الخلية إلى داخل الخلية ، على سبيل المثال ، عن طريق تغيير توافقي عند ربط الترابط. "المرساة الغشائية" هي مجال عبر الغشاء يحافظ على عديد الببتيد في موضعه في غشاء الخلية أو الغلاف الفيروسي وهو بشكل عام كاره للماء. قد يكون المرساة الغشائية بشكل عام في هيكل حلزون ألفا ، أي "حلزون عبر الغشاء". قد تحتوي البروتينات متعددة الغشاء على عدة حلزونات ألفا عبر الغشاء.

"إشارة التوطين النووي" هي سلسلة من الأحماض الأمينية التي تسمح بدخول عديد ببتيد إلى نواة الخلية من خلال المسام النووية. تحتوي إشارة التوطين النووي عمومًا على مجموعة من المخلفات موجبة الشحنة ، على سبيل المثال ، ليسين. "التسلسل الغني باللايسين" هو تسلسل يحتوي على الأقل على بقايا ليسين متجاورتين ، أو على الأقل ثلاث بقايا ليسين متجاورة. في بعض النماذج ، قد يكون التسلسل الغني باللايسين إشارة توطين نووي.

"مجال ربط ATP" هو مجال إجماع موجود في العديد من بروتينات ربط ATP أو GTP ، والتي تشكل حلقة مرنة (حلقة P) بين نطاقات الألواح المطوية alpha-helical و beta. قد يكون الإجماع العام لمجال ربط ATP (A أو G) -XXXXGK- (S أو T).

"بروتين ربط RNA" هو بروتين قادر على الارتباط بجزيء RNA (انظر ، على سبيل المثال ، "RNA Binding Proteins: New Concepts in Gene Regulation" الطبعة الأولى ، محرران K. Sandberg و SE Mulroney، Kluwers Academic Publishers ، 2001). قد تحتوي بروتينات ربط الحمض النووي الريبي (RNA) على سمات هيكلية شائعة مثل المسالك الغنية بالأرجينين ، على سبيل المثال ، الأرجينين بالتناوب مع الأسبارتات ، والسيرين ، أو الجليسين ، أو مناطق أصابع الزنك. قد تحتوي بروتينات ربط الحمض النووي الريبي أيضًا على مجال تسلسل ريبونوكليوتيد مشترك. يُعتقد أن بروتينات ربط الحمض النووي الريبي (RNA) تلعب أدوارًا متنوعة في تعديل التعبير الجيني بعد النسخ.

تتضمن "الاستجابة المناعية" ، على سبيل المثال لا الحصر ، واحدًا أو أكثر من الاستجابات التالية في الثدييات: تحريض الأجسام المضادة ، والخلايا البائية ، والخلايا التائية (بما في ذلك الخلايا التائية المساعدة ، والخلايا التائية الكابتة ، والخلايا التائية السامة للخلايا ، والخلايا التائية) ) موجه بشكل خاص إلى المستضد (المستضدات) في تركيبة أو لقاح ، بعد إعطاء التركيبة أو اللقاح. وبالتالي ، فإن الاستجابة المناعية لتركيبة أو لقاح تتضمن بشكل عام التطور في الثدييات المضيفة لاستجابة خلوية و / أو بوساطة الجسم المضاد للتركيب أو اللقاح محل الاهتمام. بشكل عام ، ستؤدي الاستجابة المناعية إلى الوقاية أو الحد من الإصابة بفيروس السارس.

يشير "جزء مناعي" من جزيء متعدد البيبتيد أو حمض نووي إلى تسلسل حمض أميني أو نيوكليوتيد يثير استجابة مناعية. وبالتالي ، يمكن أن يشتمل الجزء المستحدث للمناعة ، على سبيل المثال لا الحصر ، على أي جزء من أي من متواليات فيروس السارس الموصوفة هنا ، أو تسلسل مطابق له إلى حد كبير ، والذي يتضمن واحدًا أو أكثر من الحاتمات (محدد المستضد ، أي الموقع المعترف به بواسطة خلية جهاز مناعي معينة ، مثل خلية T أو خلية B). قد تشتمل "القمة" على أحماض أمينية في اتجاه مكاني بحيث تكون غير متجاورة في تسلسل الأحماض الأمينية ولكنها قريبة من بعضها البعض بسبب التشكل ثلاثي الأبعاد لعديد الببتيد. قد تشتمل الحاتمة على ما لا يقل عن 3 أو 5 أو 8 أو 10 أو أكثر من الأحماض الأمينية. يمكن التعرف على الشظايا أو الحلقات المناعية باستخدام الطرق القياسية المعروفة لمن يتمتعون بالمهارة في المجال ، مثل تقنيات رسم خرائط الحاتمة أو مخططات الاستضداد أو المعالجة المائية باستخدام ، على سبيل المثال ، برنامج Omiga الإصدار 1.0 من مجموعة أكسفورد الجزيئية (انظر ، على سبيل المثال ، الولايات المتحدة) براءة الاختراع رقم 4،708،871). يمكن أيضًا تحديد الشظايا أو الحلقات المناعية باستخدام طرق لتحديد بنية جزيئية ثلاثية الأبعاد مثل علم البلورات بالأشعة السينية أو الرنين المغناطيسي النووي.

قد تكون "العينة" خزعة من الأنسجة ، أو السائل الأمنيوسي ، أو الخلية ، أو الدم ، أو المصل ، أو البلازما ، أو البول ، أو البراز ، أو البلغم ، أو الملتحمة ، أو أي عينة أخرى ، أو أي مستخلص منها ، تم الحصول عليه من مريض (بشري أو حيوان) ، اختبار موضوع أو حيوان تجريبي. قد تكون "العينة" أيضًا خلية أو خط خلوي تم إنشاؤه في ظل ظروف تجريبية ، ومكوناتها (مثل مكملات استنبات الخلية ، وكسور الخلايا ، والخلايا المصابة ، وما إلى ذلك). يمكن تحليل العينة لاكتشاف وجود جين فيروس سارس أو جينوم أو بولي ببتيد أو جزيء الحمض النووي أو فيريون ، أو لاكتشاف طفرة في جين فيروس سارس ، أو مستويات التعبير لجين فيروس سارس أو عديد ببتيد ، أو الوظيفة البيولوجية بولي ببتيد فيروس السارس ، باستخدام طرق معروفة في المجال. على سبيل المثال ، يمكن استخدام طرق مثل التسلسل ، وتحليل تعدد الأشكال المطابق لشريط واحد (SSCP) ، أو تحليل تعدد الأشكال لطول جزء (RFLP) لمنتجات PCR المشتقة من عينة لاكتشاف طفرة في جين فيروس السارس ELISA أو النشاف الغربي يمكن استخدامها لقياس مستويات بولي ببتيد فيروس السارس أو تقارب الجسم المضاد ، يمكن استخدام النشاف الشمالي لقياس مستويات SARS mRNA ، أو يمكن استخدام PCR لقياس مستوى جزيء الحمض النووي لفيروس السارس.

سوف تظهر ميزات ومزايا أخرى للاختراع من الوصف التالي للرسومات والاختراع ومن عناصر الحماية.

وصف مختصر للرسومات

تين. يُظهر الشكل 1A-D تحليلات النشوء والتطور لبروتينات السارس. تم إنشاء أشجار النشوء والتطور غير المقطوعة بواسطة clustalw (Thompson ، J.D. et al. ، الدقة الأحماض النووية 22 ، 4673-80 ، 11 نوفمبر 1994) تحليل التمهيد باستخدام 1000 تكرار. مدخلات Genbank لتسلسل البروتين هي كما يلي: FIG. 1A: Replicase 1A: BoCov (Bovine Coronavirus): AAL40396، 229E (فيروس كورونا البشري): NP07355، MHV (فيروس التهاب الكبد الفيروسي): NP045298، AIBV (فيروس التهاب الشعب الهوائية المعدية للطيور): CAC39113، TGEV (فيروس التهاب المعدة والأمعاء المعدية): NP058423. الشكل. 1 ب: مصفوفة بروتين سكري: PHEV (فيروس التهاب الدماغ والنخاع الدموي الخنازير): AAL80035 ، BoCov (Bovine Coronavirus): NP150082، AIBV & amp AIBV2 (فيروس التهاب الشعب الهوائية المعدية للطيور): AAF35863 & amp AAK83027، MHV (فيروس التهاب الكبد بالفأر): AAF36439، TGEV (فيروس التهاب المعدة والأمعاء المعدية): NP058427، 229E & amp OC43 (فيروس كورونا البشري): NP073555 & amp AAA45462، FCV (فيروس كورونا القطط): BAC01160. تين. 1C: نوكليوكابسيد: MHV (فيروس التهاب الكبد الفأري): P18446 ، BoCov (فيروس كورونا البقري): NP150083 ، AIBV (فيروس التهاب الشعب الهوائية المعدية لدى الطيور): AAK27162 ، FCV (فيروس كورونا الماكر): CAA74230 ، PTGV (فيروس التهاب المعدة والأمعاء المعدي الخنازير): AAM97563، 229E & amp OC43 (فيروس كورونا البشري): NP073556 & amp P33469، PHEV (فيروس التهاب الدماغ والنخاع الدموي الخنازير): AAL80036، TCV (فيروس كورونا التركي): AAF23873. تين. 1D: S (Spike) Protein: BoCov (فيروس كورونا البقري): AAL40400، MHV (فيروس التهاب الكبد بالفأر): P11225، OC43 & amp 229E (فيروس كورونا البشري): S44241 & amp AAK32191، PHEV (فيروس التهاب الدماغ والنخاع الخنازير): AAL80031، PRC (فيروس التهاب الدماغ والنخاع): AAL80031، PRC فيروس كورونا التنفسي): AAA46905 ، PEDV (فيروس الإسهال الوبائي الخنازير): CAA80971 ، CCov (فيروس كورونا الكلاب): S41453 ، FICV (فيروس التهاب الصفاق المعدي في القطط): BAA06805 ، AIBV (فيروس التهاب الشعب الهوائية المعدية لدى الطيور): AA034396.

تين. يوضح الشكل 2 تمثيلًا تخطيطيًا لعنصر ORFs و s2m في جينوم فيروس SARS المكون من 29736 قاعدة.

تين. يُظهر 3A-P متواليات النوكليوتيدات للجينوم المكون من 29.736 قاعدة لفيروس السارس (رقم تعريف التسلسل: 1 و 2).

تين. يوضح الشكل 4 محاذاة مناطق s2m من فيروس التهاب الشعب الهوائية المعدية للطيور (رقم تعريف تسلسل AIBV: 32) والنمط المصلي 2 لفيروس الأنفلونزا الخيلي (رقم معرف التسلسل ERV-2: 31) مع المنطقة غير المترجمة 3 (رقم تعريف تسلسل UTR: 18) من فيروس السارس (TOR2). يُشار إلى المناطق المحفوظة في منطقة s2m بعلامات نجمية.

تين. يوضح الشكل 5 تسلسل الأحماض الأمينية لفيروس السارس S (سبايك) بروتين سكري (رقم معرف التسلسل: 33).

تين. يوضح الشكل 6 تسلسل الحمض الأميني لفيروس السارس M (مصفوفة) بروتين سكري (بقايا 1-220 من رقم معرف التسلسل: 34).

تين. يوضح الشكل 7 تسلسل الأحماض الأمينية لبروتين فيروس سارس E (مغلف صغير) (رقم معرف التسلسل: 35).

تين. يوضح الشكل 8 تسلسل الحمض الأميني لبروتين فيروس السارس N (Nucleocapsid) (رقم معرف التسلسل: 36).

تين. يوضح الشكل 9 محاذاة المصفوفة للبروتين السكري M من فيروس السارس (Tor2_M أو ORF5 SEQ ID NO: 34) والعديد من البروتينات السكرية المصفوفة الأخرى (أرقام معرّف التسلسل: 37-43). تشير العلامات النجمية (*) إلى هوية النسبة المئوية لبروتين مصفوفة السارس كما تم حسابه بواسطة Align (Myers and Miller ، CABIOS (1989) 4: 11-17).

تين. يُظهر 10A-B محاذاة البروتين nucleocapsid N من فيروس tehj SARS (رقم تعريف Tor2_N SEQ: 36) والعديد من البروتينات الأخرى nucleocapsid (رقم تعريف التسلسل: 44-52 و SEQ ID NO: 199 من AIBV2 بروتين nucleocapsid [فيروس التهاب الشعب الهوائية المعدية للطيور 2]). تشير العلامات النجمية (*) إلى هوية النسبة المئوية لبروتين السارس nucleocapsid المحسوبة بواسطة Align (Myers and Miller ، CABIOS (1989) 4: 11-17).

تين. يُظهر الشكل 11A-K تسلسل النوكليوتيدات للجينوم المكون من 29751 قاعدة لفيروس السارس (رقم معرف التسلسل: 15).

تين. يوضح الشكل 12 تمثيلًا تخطيطيًا لعنصر ORFs و s2m في جينوم فيروس SARS المكون من 29751 قاعدة.

تين. يُظهر 13A-D تحليلات النشوء والتطور لبروتينات السارس. تم إنشاء أشجار النشوء والتطور غير المتجذرة بواسطة clustalw 1.74 (JD Thompson ، DG Higgins ، TJ Gibson ، Nucleic Acids Res 22 ، 4673-80 (11 نوفمبر 1994) باستخدام مصفوفة مقارنة BLOSUM وتحليل التمهيد لـ 1000 تكرار. تشير الأرقام إلى تكرارات bootstrap دعم كل عقدة. تم رسم أشجار النشوء والتطور باستخدام برنامج Phylip Drawtree 3.6a3 (Felsenstein، J. 1993. PHYLIP (حزمة الاستدلال التطوري) الإصدار 3.5 ج. وزعته المؤلف. قسم علم الوراثة ، جامعة واشنطن ، سياتل). أطوال الفروع تشير إلى عدد الاستبدالات لكل بقايا مدخلات Genbank لتسلسل البروتين: A: Replicase 1ج: BoCoV (Bovine Coronavirus): AAL40396 ، HCoV-229E (فيروس كورونا البشري): NP07355، MHV (فيروس التهاب الكبد الفيروسي): NP045298، IBV (فيروس التهاب الشعب الهوائية المعدية لدى الطيور): CAC39113، TGEV (فيروس التهاب المعدة والأمعاء المعدية): NP058423. B: غشاء بروتين سكري: PHEV (فيروس التهاب الدماغ والنخاع الدموي في الخنازير): AAL80035 ، BoCoV (Bovine Coronavirus): NP150082، IBV & amp IBV2 (فيروس التهاب الشعب الهوائية المعدية للطيور): AAF35863 & amp AAK83027 ، MHV (فيروس التهاب الكبد بالفأر): AAF36439 ، TGEV (فيروس التهاب المعدة والأمعاء المعدية): NP058427، HCoV-229E & amp HCoV-OC43 (فيروس كورونا البشري): NP073555 & amp AAA45462، FCoV (فيروس كورونا القطط): BAC01160. C: Nucleocapsid: MHV (فيروس التهاب الكبد الفأري): P18446 ، BoCoV (فيروس كورونا البقري): NP150083، IBV 1 & amp 2 (فيروس التهاب الشعب الهوائية المعدية للطيور): AAK27162 & amp NP040838، FCoV (فيروس كورونا الماكر): CAA74230، PTGV (فيروس التهاب المعدة والأمعاء المعدي الخنازير): AAM97563، HCoV-229E & amp HCoV-OC43 (فيروس كورونا البشري): NP073556 & amp P33469، PHEV (فيروس التهاب الدماغ والنخاع الدموي الخنازير): AAL80036، TCV (فيروس كورونا التركي): AAF23873. D: S (Spike) Protein: BoCoV (فيروس كورونا البقري): AAL40400، MHV (فيروس التهاب الكبد الفأري): P11225، HCoV-OC43 & amp HCoV-229E (فيروس كورونا البشري): S44241 & amp AAK32191، PHEV (فيروس التهاب الدماغ والنخاع الخنازير): ، PRCOV (فيروس كورونا التنفسي الخنازير): AAA46905 ، PEDV (فيروس الإسهال الوبائي الخنازير): CAA80971 ، CCoV (فيروس كورونا الكلاب): S41453 ، FIPV (فيروس التهاب الصفاق المعدي في القطط): BAA06805 ، IBV (فيروس التهاب الشعب الهوائية المعدية لدى الطيور): AAO34396.

تين. يُظهر الشكل 14A-F محاذاة البروتين السكري المرتفع S من فيروس السارس (رقم تعريف تسلسل Tor2_S: 33) والعديد من البروتينات السكرية الأخرى المرتفعة (أرقام معرّف التسلسل: 53-62). تشير العلامات النجمية (*) إلى هوية النسبة المئوية لبروتين ارتفاع السارس كما تم حسابه بواسطة Align (Myers and Miller ، CABIOS (1989) 4: 11-17).

تين. يوضح الشكل 15 محاذاة بين بروتين المغلف الصغير لفيروس سارس E (رقم تعريف التسلسل TOR2_E: 35) وبروتين المغلف (البروتين 4) (بروتين X1) (ORF 3) من فيروس التهاب المعدة والأمعاء الناجم عن التهاب المعدة والأمعاء الخنازير (سلالة بوردو). رقم الانضمام إلى Swissprot P09048 (PGV SEQ ID NO: 63) ، كما تم حسابه بواسطة FASTA (شبكة الويب العالمية في ebi “dot” ac “dot” uk “forward slash” fasta33).

تين. يُظهر الشكل 16A-B تسلسل الأحماض الأمينية لبروتين 1A المتماثل لفيروس السارس (رقم معرف التسلسل: 64).

تين. يوضح الشكل 17 تسلسل الأحماض الأمينية لبروتين 1B لفيروس SARS Replicase (رقم معرف التسلسل: 65).

تين. يوضح الشكل 18 تسلسل الأحماض الأمينية لـ ORF3 لفيروس السارس (رقم معرف التسلسل: 66).

تين. يوضح الشكل 19 تسلسل الأحماض الأمينية لـ ORF4 لفيروس السارس (رقم معرف التسلسل: 67).

تين. يوضح الشكل 20 تسلسل الأحماض الأمينية (رقم معرف التسلسل: 68) لـ ORF6 (النيوكليوتيدات 27059-27247 من تسلسل الجينوم المكون من 29.736 قاعدة) أو ORF 7 (النيوكليوتيدات 27،074-27،265 من تسلسل الجينوم 29،751) لفيروس السارس.

تين. يوضح الشكل 21 تسلسل الأحماض الأمينية (رقم معرف التسلسل: 69) لـ ORF7 (النيوكليوتيدات 27258-27623 من تسلسل الجينوم المكون من 29.736 قاعدة) أو ORF 8 (النيوكليوتيدات 27273-27641 من تسلسل الجينوم ذي القاعدة 29751) لفيروس سارس.

تين. يوضح الشكل 22 تسلسل الأحماض الأمينية (رقم معرف التسلسل: 70) لـ ORF8 (النيوكليوتيدات 27623-27754 من تسلسل الجينوم المكون من 29.736 قاعدة) أو ORF9 8 (النيوكليوتيدات 27،638-27،772 من تسلسل الجينوم ذي القاعدة 29،751) لفيروس السارس.

تين. يوضح الشكل 23 تسلسل الأحماض الأمينية (رقم معرف التسلسل: 71) لـ ORF9 (النيوكليوتيدات 27764-27880 من تسلسل الجينوم المكون من 29.736 قاعدة) أو ORF10 (النيوكليوتيدات 27779-27898 من تسلسل الجينوم ذي القاعدة 29751) لفيروس سارس.

تين. يوضح الشكل 24 تسلسل الأحماض الأمينية (رقم معرف التسلسل: 72) لـ ORF10 (النيوكليوتيدات 27849-28100 من تسلسل الجينوم المكون من 29.736 قاعدة) أو ORF11 (النيوكليوتيدات 27864-28118 من تسلسل الجينوم 29751 الأساسي) لفيروس السارس.

تين. يوضح الشكل 25 تسلسل الأحماض الأمينية لـ ORF13 لفيروس السارس (رقم معرف التسلسل: 73).

تين. يوضح الشكل 26 تسلسل الأحماض الأمينية لـ ORF14 لفيروس السارس (رقم معرف التسلسل: 74).

تين. يوضح الشكل 27 محاذاة المنطقة التي تم إفرازها من فيروس السارس ORF 10 (رقم معرف التسلسل: 201) من تسلسل الجينوم المكون من 29751 قاعدة (سارس) مع السموم من المخروط البطيني (كونوتوكسين) (رقم تعريف التسلسل: 200). يُشار إلى هوية التسلسل بعلامات النجمة ويُشار إلى تجانس التسلسل بالنقاط.

وصف تفصيلي للاختراع

بشكل عام ، يوفر الاختراع جزيئات الحمض النووي وعديد البيبتيدات والكواشف الأخرى المشتقة من فيروس السارس ، بالإضافة إلى طرق استخدام جزيئات الحمض النووي وعديد الببتيدات والكواشف الأخرى.

تسلسل الجينوم (الأشكال 3A-P ، 11يكشف A-K و SEQ ID NOs: 1 و 2 و 15) أن فيروس سارس التاجي مرتبط بشكل معتدل فقط بفيروسات كورونا الأخرى المعروفة ، بما في ذلك اثنين من فيروسات كورونا البشرية ، OC43 و 229E. وبالتالي ، فإن فيروس السارس هو فيروس غير معروف من قبل. يحتوي جينوم السارس 5 على تسلسل 5 زعيم (الجدول 1 رقم معرف التسلسل: 3) مع تشابه تسلسلي مع تسلسل القائد الأساسي لفيروس كورونا المحفوظ للغاية ، 5′-CUAAAC-3 (رقم معرف التسلسل: 75 Sawicki ، SG ، وآخرون.، أدف إكس ميد بيول 440، 215-9، 1998 Lai، M. and D. Cavanagh، ادف فيروس الدقة 48 ، 1-100 ، 1997). تم تحديد التسلسلات التنظيمية للنسخ (TRSs) في بداية جميع إطارات القراءة المفتوحة (ORFs) (الجدولان 1 و 2 أرقام تعريف التسلسل: 3-13 و 20-30). يتداخل ORF9 و ORF10 من جينوم SARS المكون من 29.736 قاعدة (ORF 10 و ORF 11 من 29751 من الجينوم الأساسي) بواسطة 12 حمضًا أمينيًا ، ويتطابقان مع إجماع TRS على مقربة من أكواد الميثيونين الخاصة بهما.

يحتوي تسلسل 3 ′ UTR (رقم معرف التسلسل: 18) لفيروس SARS على منطقة s2m بها تسلسل ACATTTTCATCGAGGCCACGCGGAGTACGAT CGAGGGTACAGTGAAT SEQ ID NO: 16) يتضمن عزرًا محفوظًا متقطعًا 32 زوجًا أساسيًا s2m. الشكل 32 زوجًا أساسيًا المحفوظ هو سمة عالمية للفيروسات النجمية التي تم تحديدها أيضًا في فيروس كورونا للطيور (AIBV) وفيروس الأنف الخيلي ERV-2. تم تحديد هذا الشكل بواسطة Jonassen C.M et al. (J Gen Virol 1998 April 79 (Pt 4): 715-8) كـ GCCGNGGCCACGC (G / C) GAGTA (C / G) GANCGAGGGTACAG (G / C) (رقم معرف التسلسل: 19) ، حيث لا يكون N بشكل عام جزءًا من الحافز المحفوظ ، ويمكن أن يكون أي نوكليوتيد. تتضمن المنطقة المقابلة لعزر الزوج الأساسي 32 في فيروس السارس التسلسل: CGAGGCCACGCGGAGTACGATCGAGGGTACAG (رقم معرف التسلسل: 17) ، وتمتد المواضع 29590-29621 من الجينوم الأساسي 29751. تين. يوضح الشكل 4 محاذاة مناطق s2m من فيروس التهاب الشعب الهوائية المعدية للطيور (رقم تعريف تسلسل AIBV: 32) والنمط المصلي 2 لفيروس الأنفلونزا الخيلي (رقم معرف التسلسل ERV-2: 31) ، على النحو المحدد في Jonassen C.M et al. (J Gen Virol 1998 April 79 (Pt 4): 715-8) ، مع كامل المنطقة غير المترجمة 3 (UTR) لفيروس السارس (TOR2) (رقم تعريف التسلسل: 18).

تم تصوير إمكانات الترميز للجينوم 29736 قاعدة و 29751 قاعدة في الأشكال. 2 و 12 على التوالي. تتضمن إطارات القراءة المفتوحة (ORFs) منتجات الترجمة Replicase 1a و 1b ، والبروتين السكري Spike ، وبروتين Envelope الصغير ، والغشاء ، وبروتين Nucleocapsid. يكشف بناء أشجار النشوء والتطور غير المتجذرة باستخدام هذه المجموعة من البروتينات المعروفة من ممثلي المجموعات الفيروسية التاجية الثلاثة المعروفة أن البروتينات المشفرة بواسطة فيروس السارس لا تتجمع بسهولة مع أي مجموعة معروفة أكثر من أي مجموعة أخرى (الأشكال 1A-D و 13ميلادي). بالإضافة إلى ذلك ، تم تحليل تسعة ORFs جديدة.

يقع Replicase 1a ORF في النيوكليوتيدات 250-13395 من الجينوم 29736 قاعدة ، والنيوكليوتيدات 265-13398 من 29751 قاعدة الجينوم ، و 1b ORF الموجود في النيوكليوتيدات 13395-21467 من الجينوم 29736 قاعدة ، ونيوكليوتيدات 13398- 21485 من 29751 قاعدة جينوم ، تحتل 21.2 كيلو بايت من جينوم فيروس السارس (الشكلان 2 و 12). تقوم هذه الجينات بتشفير عدد من البروتينات التي يتم إنتاجها عن طريق الانقسام التحليلي للبروتين متعدد البروتينات الكبيرة (Ziebuhr، J. et al.، ياء الجنرال فيرول 81 ، 853-79 ، أبريل 2000). تقاطع طفرة تحول الإطار منطقة ترميز البروتين ، وتفصل إطارات القراءة المفتوحة 1a و 1b. تم تصوير البروتينات المشفرة بواسطة Replicase 1a و 1b ORFs في التين. 16A-B و 17، أرقام معرف التسلسل: 64 و 65).

يشفر البروتين السكري Spike (S) (جين E2 بروتين سكري الشكل 2 و 12 نيوكليوتيدات 21477 إلى 25241 من 29736 قاعدة جينوم ونيوكليوتيدات 21492 إلى 25259 من 29751 من الجينوم الأساسي) يشفر إسقاطًا سطحيًا للبروتينات السائلة في 1،25 الطول (الشكل 5 رقم تعريف التسلسل: 33) ، والذي قد يكون مهمًا في ضراوة فيروس السارس. ترتبط الطفرات في هذا الجين بالتطور المرضي والفوعة في فيروسات كورونا الأخرى (B.N Fields et al. ، علم الفيروسات الحقول (ليبينكوت ويليامز وأمب ويلكينز ، فيلادلفيا ، الطبعة الرابعة ، 2001). في فيروسات كورونا الأخرى ، يتم إدخال بروتين السنبلة الناضج في الغلاف الفيروسي مع كشف غالبية البروتين على سطح الجزيئات. تشكل ثلاثة جزيئات من بروتين سبايك البليومرات المميزة أو الهياكل الشبيهة بالإكليل لعائلة الفيروس هذه. تحليل البروتين السكري المرتفع مع SignalP (Nielson ، H. et al. ، مهندس بروت. 10: 1-6 (1997) يشير إلى ببتيد إشارة (رقم معرّف تسلسل MFIFLLFLTLTSG: 76) (احتمال 0.996) مع انقسام بين البقايا 13 و 14. TMHMM (Sonnhammer، E. L. et al.، بروك Int Conf Intell Syst Mol Biol 6 ، 175-82 (1998)) يشير إلى مجال عبر الغشاء بالقرب من الطرف C (WYVWLGFIAGLIAIVMVTILLCC SEQ ID NO: 183). تشير هذه البيانات معًا إلى بروتين غشائي من النوع الأول به طرف N وأغلبية البروتين (المخلفات 14-1195) على السطح الخارجي لسطح الخلية أو جسيم الفيروس ، والذي قد يكون مسؤولاً عن الارتباط بمستقبل خلوي. فيروس السارس Spike لديه هوية تسلسلية محدودة للبروتينات السكرية Spike المعروفة (الأشكال 14A-F).

ORF 3 (الشكلان 2 و 12 نيوكليوتيدات 25253-26074 من 29736 قاعدة جينوم ونيوكليوتيدات 25268-26.092 من الجينوم 29751 قاعديًا) يشفر بروتينًا مكونًا من 274 حمضًا أمينيًا (الشكل 18 رقم تعريف التسلسل: 66) يفتقر إلى أهمية أوجه التشابه مع أي بروتين معروف عند تحليله باستخدام BLAST (Altschul ، SF et al. ، الدقة الأحماض النووية 25 ، 3389-402 ، 1 سبتمبر 1997) ، فاستا (بيرسون ، دبليو آر ودي جي ليبمان ، بروك ناتل أكاد علوم الولايات المتحدة الأمريكية 85 ، 2444-8 ، أبريل ، 1988) أو PFAM (Bateman ، A. et al. ، الدقة الأحماض النووية 30 ، 276-80 ، 1 يناير 2002). يشير تحليل الأحماض الأمينية N-terminal 70 مع SignalP إلى وجود ببتيد إشارة (MDLFMRFFTLRSITAQ SEQ ID NO: 184) وموقع انشقاق (احتمال 0.540). كلاهما TMpred (Hofinan، K. and W. Stoffel، بيول. تشيم. هوب-سيلر 374 ، 166 (1993) و TMHMM تشير إلى ثلاث مناطق عابرة للأغشية تمتد تقريبًا من المخلفات 34-56 (TIPLQASLPFGWLVIGVAFLAVF ، رقم معرف التسلسل: 77) ، 77-99 (FQFICNLLLFVTIYSHLLLVAA ، رقم معرف التسلسل: 78) ، و 103-125 (AQRIAL) رقم معرف التسلسل: 79). يشير كل من TMpred و TMHMM إلى أن الطرف C ومجال كبير من الأحماض الأمينية 149 يقع داخل الغشاء الفيروسي أو الخلوي. و(الداخلية) المنطقة C-محطة من البروتين، أي ما يعادل حوالي الأحماض الأمينية 124-274 (MRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGI STPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENAT FFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL SEQ ID NO: 185) قد ترميز مجال البروتين مع خصائص ملزم ATP (PD037277).

ORF 4 (الشكل 12 نيوكليوتيدات 25،689-26،153 من 29،751 جينوم قاعدي) يشفر بروتينًا متوقعًا مكونًا من 154 حمض أميني (الشكل 19 رقم تعريف التسلسل: 67). يتداخل ORF هذا تمامًا مع ORF 3 وبروتين E. يمكن التعبير عن ORF4 من ORF mRNA باستخدام موقع إدخال ريبوسوم داخلي. فشلت تحليلات بلاست في تحديد تسلسل المطابقة. يتنبأ التحليل باستخدام TMPred بوجود حلزون عبر غشاء واحد ، وأحماض أمينية 1-20 MMPTTLFAGTHITMTTVYHI ، رقم معرف التسلسل: 186.

بروتين المغلف الصغير E (الشكلان 2 و 12 نيوكليوتيدات 26102-26329 من 29736 قاعدة جينوم ونيوكليوتيدات 26117-26347 ، ORF 5 ، من 29751 جينوم) يشفر بروتينًا مكونًا من 76 حمضًا أمينيًا (الشكل 7 SEQ ID NO : 35). تشير مقارنات BLAST و FASTA إلى أن البروتين ، على الرغم من أنه جديد ، مماثل لبروتينات غلاف متعددة (تُعرف أيضًا باسم بروتينات الغشاء الصغير) من عدة فيروسات كورونا. تشير محاذاة بروتين فيروس السارس E مع بروتين مغلف لفيروس التهاب المعدة والأمعاء المعدي الخنازير إلى ما يقرب من 28 ٪ من هوية التسلسل بين البروتينين على تداخل 61 من الأحماض الأمينية ، كما تم حسابه بواسطة FASTA (الشكل 15). يشير تحليل PFAM للبروتين إلى أن بروتين المغلف الصغير E هو عضو في عائلة بروتين NS3_EnvE. InterProScan (R. Apweiler et al. ، الدقة الأحماض النووية 29 ، 37-40 ، 1 يناير 2001 ، Zdobnov ، E.M and R. Apweiler ، المعلوماتية الحيوية 17 ، 847-8 ، سبتمبر 2001) يشير التحليل إلى أن البروتين هو أحد مكونات الغلاف الفيروسي ، وتوجد متماثلاته في فيروسات أخرى ، بما في ذلك فيروس التهاب المعدة والأمعاء وفيروس التهاب الكبد الوبائي. يشير تحليل SignalP إلى وجود مرساة عبر الغشاء (الاحتمال 0.939). يشير تحليل TMpred إلى مرساة غشائية مماثلة في المواضع 17-34 (VLLFLAFVVFLLVTLAIL ، SEQ ID NO: 80) ، وهو ما يتوافق مع الارتباط المعروف للبروتينات المتماثلة مع الغلاف الفيروسي. يشير TMHMM إلى بروتين غشاء من النوع الثاني مع غالبية 46 بقايا من المجال المحب للماء (TALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV SEQ ID NO: 187) الموجود على سطح الجسيم الفيروسي. قد يكون البروتين E مهمًا لتكاثر الفيروس.

يشفر Matrix glycoprotein M (الشكلان 2 و 12 نيوكليوتيدات 26383-27045 من 29736 قاعدة الجينوم والنيوكليوتيدات 26398-27.063 ، ORF 6 ، من 29751-جينوم) بروتينًا من 221 من الأحماض الأمينية (الشكل 6 SEQ ID NO: 34). يكشف تحليل BLAST و FASTA للبروتين ، في حين أنه جديد ، عن تماثلات للبروتينات السكرية لمصفوفة الفيروس التاجي (الشكل 9). قد يكون ارتباط البروتين السكري السنبلة (S) بالبروتين السكري المصفوف (M) خطوة أساسية في تكوين الغلاف الفيروسي وفي تراكم كلا البروتينين في موقع تجمع الفيروس. يشير تحليل تسلسل الأحماض الأمينية باستخدام SignalP إلى تسلسل إشارة (الاحتمال 0.932) ، الموجود عند المخلفات تقريبًا 1-39 (MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYS SEQ ID NO: 188) من غير المرجح أن يتم قطعه. يشير كل من تحليل TMHMM و TMpred إلى وجود ثلاث حلزونات عبر الغشاء ، تقع في المخلفات تقريبًا 15-37 (LLEQWNLVIGFLFLAWIMLLQFA SEQ ID NO: 81) ، 50-72 (LVFLWLLWPVTLACFVLAAVYRI SEQ ID NO: 82) و 77-99 (GGIAWI) NO: 83) ، مع المجال 121 من الأحماض الأمينية المحبة للماء داخل جسيم الفيروس ، حيث قد يتفاعل مع nucleocapsid. يمكن تشغيل المجال المحبة للماء من ما يقرب من الأحماض الأمينية PLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLS YYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ221 (NO SEQ ID NO: 189) أي متواليات PAM (رقم 95 مطابقًا تقريبًا لـ 95). في قاعدة بيانات PFAM التي تحمل هذا المجال ، مما يدل على البروتين السكري لمصفوفة الفيروس التاجي.

ORF6 (الشكل 2 نيوكليوتيدات 27059-27247 من تسلسل الجينوم المكون من 29.736 قاعدة) أو ORF 7 (الشكل 12 نيوكليوتيدات 27.074-27265 من تسلسل الجينوم ذي القاعدة 29751) يشفر بروتينًا مكونًا من 63 حمضًا أمينيًا (الشكل 20 رقم تعريف التسلسل : 68). يشير تحليل TMpred إلى حلزون عبر غشاء يقع بين المخلفات 3 أو 4 و 22 (HLVDFQVTIAEILIIIMRTF SEQ ID NO: 84) ، مع الطرف N الموجود خارج الجسيم الفيروسي.

وبالمثل ، فإن الجين المشفر ORF7 (الشكل 2 نيوكليوتيدات 27258-27623 من تسلسل الجينوم المكون من 29.736 قاعدة) أو ORF 8 (الشكل 12 نيوكليوتيدات 27.273-27.641 من تسلسل الجينوم 29751 قاعدي) ، يشفر بروتينًا يتكون من 122 حمضًا أمينيًا ( الشكل 21 رقم تعريف التسلسل: 69) ، لا يحتوي على تطابق BLAST أو FASTA مع البروتينات المعروفة. يشير تحليل هذا التسلسل باستخدام SignalP إلى تسلسل إشارة مشقوق (رقم معرف التسلسل MKIILFLTLIVFTSC: 85) (الاحتمال 0.995) ، مع موقع الانقسام الواقع بين المخلفات 15 و 16. يشير تحليل TMpred و TMHMM أيضًا إلى حلزون عبر غشاء يقع تقريبًا في المخلفات 99-117 (رقم تعريف التسلسل SPLFLIVAALVFLILCFTI: 86). تشير هذه البيانات مجتمعة إلى أن هذا البروتين هو بروتين غشائي من النوع الأول مع المجال المحب للماء الرئيسي للبروتين (المخلفات 16-98 ELYHYQECVRGTTVLLKEPCP SGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQ EEVQino-SEQ المصطلح: ، أو على سطح غشاء الخلية أو جسيم الفيروس ، اعتمادًا على توطين غشاء البروتين.

ORF8 (الشكل 2 نيوكليوتيدات 27623-27754 من تسلسل الجينوم ذي القاعدة 29،736) أو ORF9 (الشكل 12 نيوكليوتيدات 27،638-27،772 من تسلسل الجينوم ذي القاعدة 29،751) ، يشفر بروتينًا مكونًا من 44 من الأحماض الأمينية (الشكل 22 رقم تعريف التسلسل : 70). كشف تحليل FASTA لهذا التسلسل عن بعض أوجه التشابه الضعيفة (هوية 37 ٪ عبر 35 تداخلًا من الأحماض الأمينية) مع انضمام Swiss-Prot Q9M883 ، المشروح باعتباره ستيرول C5 desaturase المفترض. تطابق ضعيف مماثل مع نظير افتراضي المطثية الحاطمة تم الكشف أيضًا عن البروتين (دخول Swiss-Prot CPE2366). أشار TMpred إلى حلزون واحد قوي عبر الغشاء FYLCFLAFLLFLVLIMLIIFWFS ، رقم معرف التسلسل: 190 ، مع تفضيل ضئيل للنماذج البديلة التي يقع فيها الطرف N داخل الجسيم أو خارجه.

وبالمثل ORF9 (الشكل 2 نيوكليوتيدات 27764-27880 من تسلسل الجينوم المكون من 29.736 قاعدة) أو ORF10 (الشكل 12 نيوكليوتيدات 27779-27898 من تسلسل الجينوم ذي القاعدة 29751) يشفر بروتينًا مكونًا من 39 حمضًا أمينيًا (الشكل 23 رقم تعريف التسلسل : 71) ، لم يُظهر أي تطابق مهم في عمليات البحث BLAST و FASTA ولكنه يشفر الحلزون عبر الغشاء LLIVLTCISLCSCICTVVQ (رقم معرف التسلسل: 191) بواسطة TMPred ، مع وجود الطرف N داخل الجسيم الفيروسي. تُظهر المنطقة المنبع مباشرة لهذا البروتين تطابقًا قويًا مع إجماع TRS (الجدول 2) ، مما يشير إلى أن النص يبدأ من هذا الموقع. قد يؤدي العدد الكبير من بقايا السيستين (6) إلى ارتباط متقاطع للأحماض الأمينية. يمكن إفراز الأحماض الأمينية ICTVVQRCASNKPHVLEDPCKVQH (رقم تعريف التسلسل: 192) لهذا البروتين. تُظهر الأحماض الأمينية المفرزة تماثلًا للبروتينات السامة ، على سبيل المثال ، للسموم الخيطية المخروط البطيني (شكل 27). تم استخدام الببتيدات المستضدية من المنطقة المحبة للماء (المفرزة) ، على سبيل المثال ، CICTVVQRCASNKPHVLEDPCK (رقم معرف التسلسل: 193) ، لتوليد الأجسام المضادة أحادية النسيلة باستخدام التقنيات القياسية. علاوة على ذلك ، تشكل الأحماض الأمينية الطرفية C تسلسلاً يشترك في التماثل مع مواقع الانحراف (CKQH) ، والتي تتطلب عمومًا موقع المحطة C ليكون وظيفيًا. قد يعمل هذا البروتين كعامل ضراوة و / أو قد يسهل انتقاله إلى البشر.

ORF10 (الشكل 2 نيوكليوتيدات 27849-28100 من تسلسل الجينوم ذي القاعدة 29،736) أو ORF11 (الشكل 12 نيوكليوتيدات 27،864-28118 من تسلسل الجينوم المكون من 29751 قاعدة) لترميز بروتين مكون من 84 حمض أميني (الشكل 24 رقم تعريف التسلسل: 72) فقط قصيرة جدًا (9-10 بقايا) تتطابق مع منطقة من سلائف البروتين السكري لفيروس كورونا E2 البشري (بدءًا من البقايا 801). يتنبأ التحليل بواسطة SignalP و TMHMM بوجود بروتين قابل للذوبان. تم العثور أيضًا على محاذاة يمكن اكتشافها لتسلسل إجماع TRS (الجدول 2).

البروتين (422 من الأحماض الأمينية الشكل 8 رقم تعريف التسلسل: 36) مشفرًا بواسطة جين Nucleocapsid (الشكل .2 نيوكليوتيدات 28105-29370 من تسلسل الجينوم ذي القاعدة 29،736 الشكل 12 ، النيوكليوتيدات 28،120-29،388 من تسلسل الجينوم ذي القاعدة 29،751 ) يتماشى جيدًا مع بروتينات نوكليوكابسيد من فيروسات كورونا تمثيلية أخرى (الأشكال 10A-B) ، على الرغم من أن المنطقة الغنية باللايسين القصيرة (KTFPPTEPKKDKKKKTDEAQ SEQ ID NO: 14) فريدة من نوعها بالنسبة لـ SARS. توحي هذه المنطقة بإشارة توطين نووي نظرًا لأن بعض فيروسات كورونا قادرة على التكاثر في الخلايا المنضوية ، فقد يكون البروتين النووي القابسيد لفيروس السارس قد طور وظيفة نووية جديدة ، والتي قد تلعب دورًا في التسبب في المرض. بالإضافة إلى ذلك ، تشير الطبيعة الأساسية لهذا الببتيد إلى أنه قد يساعد في ربط الحمض النووي الريبي. يعتبر بروتين السارس النووي أيضًا مرشحًا جيدًا للاختبارات التشخيصية.

ORF13 (الشكل 12 نيوكليوتيدات 28،130-28،426 من تسلسل الجينوم المكون من 29،751 قاعدة) يشفر بروتينًا جديدًا مكونًا من 98 من الأحماض الأمينية (الشكل 25 رقم تعريف التسلسل: 73). ORF 14 (الشكل 12 نيوكليوتيدات 28،583-28،795 من تسلسل الجينوم ذي القاعدة 29،751) يشفر بروتينًا جديدًا مكونًا من 70 حمضًا أمينيًا (الشكل 26 رقم تعريف التسلسل: 74). تتنبأ TMPred بحلزون واحد عبر الغشاء VVAVIQEIQLLAAVGEILLLEW (رقم معرف التسلسل: 194).

يتم تلخيص الميزات المختلفة لجينوم فيروس السارس في الجدول 3. بينما يشير الجدول 3 إلى تسلسل الجينوم المكون من 29751 قاعدة ، فإن الميزات قابلة للتطبيق أيضًا على تسلسل الجينوم المكون من 29.736 قاعدة (رقم تعريف التسلسل: 1 و 2).

قد توجد أشكال متعددة مختلفة في فيروس السارس. في تسلسل الجينوم السارس 29.736 قاعدة (رقم معرف التسلسل: 1 أو 2) ، على سبيل المثال ، قد تكون النيوكليوتيدات 7904 أو 16607 أو 19168 أو 24857 أو 26842 C أو T أو النيوكليوتيدات 19049 أو 23205 أو 25283 قد تكون G أو A ، وفي تسلسل الجينوم السارس 29751 قاعدي (رقم معرف التسلسل: 15) ، على سبيل المثال ، قد تكون النيوكليوتيدات 7919 أو 16622 أو 19183 أو 24872 أو 26857 C أو T أو النيوكليوتيدات 19064 أو 23220 أو 25298 قد تكون G أو A في بعض النماذج ، قد تؤدي تغييرات النيوكليوتيدات إلى عدم حدوث تغيير في الحمض الأميني المشفر ، أو تغيير محافظ أو غير متحفظ في الحمض الأميني المشفر. في بعض النماذج ، قد يؤدي تغيير النوكليوتيدات ، كما هو موصوف هنا ، في الموضع 7904 أو 7919 ، إلى استبدال الأحماض الأمينية من A إلى V ، في منطقة تشفير البروتين Replicase 1A ، قد يؤدي التغيير في الموضع 19168 أو 19183 إلى V إلى A استبدال الأحماض الأمينية ، في منطقة ترميز بروتين Replicase IB ، قد يؤدي التغيير في الموضع 23205 أو 23220 إلى استبدال الأحماض الأمينية من A إلى S (تغيير غير متحفظ) ، مما يؤثر على منطقة ترميز Spike للبروتين السكري ، قد ينتج عن تغيير في الموضع 25283 أو 25298 في استبدال الحمض الأميني R إلى G (تغيير غير متحفظ) ، مما يؤثر على ORF3 أو تغيير في الموضع 26842 أو 26857 قد يؤدي إلى استبدال الأحماض الأمينية من S إلى P (تغيير غير متحفظ) ، مما يؤثر على منطقة ترميز البروتين Nucleocapsid ، في السارس 29.736 قاعدة (رقم معرف التسلسل: 1 أو 2) و 29751 من تسلسل الجينوم (رقم معرف التسلسل: 15) ، على التوالي. في نماذج مختلفة ، يمكن اختيار متوالية نيوكليوتيد أو حمض أميني متضمنة تعدد أشكال معين ، على سبيل المثال ، للاستخدام في طرق الاختراع ، أو يمكن استبعادها ، على سبيل المثال ، من استخدام معين وفقًا للاختراع.

تم وصف التجسيدات البديلة المختلفة للاختراع أدناه. تتضمن هذه التجسيدات ، على سبيل المثال لا الحصر ، تحديد واستخدام الحمض النووي لفيروس السارس ومتواليات الأحماض الأمينية للاستخدامات التشخيصية أو العلاجية.

تشخيص الاضطرابات المرتبطة بفيروس السارس

الاضطراب المرتبط بفيروس السارس هو أي اضطراب يتوسطه فيروس السارس أو جزيء الحمض النووي أو عديد الببتيد المشتق من فيروس السارس. وفقًا لذلك ، يمكن استخدام جزيئات الحمض النووي وبولي ببتيدات لفيروس السارس لتشخيص وتحديد الاضطراب المرتبط بفيروس السارس في أحد الثدييات ، على سبيل المثال ، الإنسان أو الحيوان المنزلي ، المزرعة ، البرية ، أو الحيوانات التجريبية. في بعض النماذج ، يمكن استخدام جزيئات الحمض النووي وعديد البيبتيدات لفيروس السارس لفحص مثل هذه الحيوانات ، على سبيل المثال ، قطط الزباد ، بحثًا عن وجود فيروس سارس. قد يكون الاضطراب المرتبط بفيروس السارس اضطرابًا كبديًا أو معويًا أو تنفسيًا أو عصبيًا ، وقد يكون مصحوبًا بواحد أو أكثر من الأعراض أو المؤشرات بما في ذلك ، على سبيل المثال لا الحصر ، الحمى والسعال وضيق التنفس والصداع وانخفاض الأكسجين في الدم التركيز أو تلف الكبد أو انخفاض عدد الخلايا الليمفاوية. وفقًا لذلك ، يمكن الحصول على عينات للتشخيص من الخلايا ، أو الدم ، أو المصل ، أو البلازما ، أو البول ، أو البراز ، أو الملتحمة ، أو البلغم ، أو مسحات البلعوم أو الفم أو البلعوم ، أو رشاشات القصبة الهوائية ، أو غسل القصبة الهوائية ، أو السائل الجنبي ، أو السائل الأمنيوسي ، أو أي عينة أخرى ، أو أي مستخلص. منها ، أو عن طريق خزعة الأنسجة على سبيل المثال الرئتين أو الأعضاء الرئيسية ، التي تم الحصول عليها من مريض (بشري أو حيوان) ، أو من موضوع الاختبار ، أو من حيوان التجارب.

يمكن تشخيص الاضطراب المرتبط بفيروس السارس عن طريق تضخيم جزيء الحمض النووي السارس أو جزء منه من عينة. يمكن تحضير المجسات أو البادئات للاستخدام في التضخيم باستخدام التقنيات القياسية. في بعض النماذج ، يتم اختيار المجسات أو البادئات من مناطق جينوم فيروس سارس كما هو موصوف هنا والتي تُظهر تماثلًا محدودًا أو هوية متسلسلة (على سبيل المثال ، أقل من 10٪ ، 20٪ ، 30٪ ، 40٪ ، 50٪ ، 60٪ ، 70 ٪ ، أو 80٪ ، أو 90٪ ، أو 100٪ هوية) لفيروسات أو مسببات الأمراض الأخرى ، أو لتسلسلات مضيفة.

يمكن تضخيم متواليات الحمض النووي حسب الحاجة بالطرق المعروفة في المجال. على سبيل المثال ، يمكن تحقيق ذلك عن طريق تفاعل البلمرة المتسلسل "PCR" للحمض النووي أو الحمض النووي الريبي بواسطة النسخ العكسي للـ PCR أو "RT-PCR" (انظر بشكل عام تقنية PCR: مبادئ وتطبيقات تضخيم الحمض النووي (محرر HA Erlich ، Freeman Press، NY، NY، 1992) بروتوكولات PCR: دليل للطرق والتطبيقات (eds. Innis، et al.، Academic Press، San Diego، California، 1990) Mattila et al.، Nucleic Acids Res.19، 4967 (1991) Eckert et al.، PCR Methods and Applications 1، 17 (1991) PCR (eds. McPherson et al.، IRL Press، Oxford) and US Pat. No. 4683،202 الصادرة في 28 يوليو 1987 إلى Mullis) تقنيات PCR القياسية ، على سبيل المثال RT-PCR في الوقت الحقيقي باستخدام الاشعال الداخلية وكذلك التضخيم ، مما يؤدي إلى زيادة الحساسية والسرعة ، وتقليل مخاطر تلوث العينة (انظر على سبيل المثال Higuchi، R.، et al.، "Kinetic تحليل PCR: المراقبة في الوقت الحقيقي لتفاعلات تضخيم الحمض النووي ، "Bio / Technology ، المجلد. 11 ، ص 1026-1030 (1993) Heid et al ،" Real Time Qua ntitative PCT "، بحث الجينوم ، 1996 ، ص 986-994 Gibson U E et al. ،" طريقة جديدة للوقت الحقيقي الكمي RT-PCR ، "Genome Res. 1996 6 أكتوبر (10): 995-1001) ، أو نهج "Tacman" لـ PCR ، الذي وصفه على سبيل المثال Holland et al، Proc. ناتل. أكاد. Sci. ، 88: 7276-7280 (1991) ، يمكن إجراؤها.

تشمل طرق التضخيم والتحليل المناسبة الأخرى تمديد قاعدة التمهيدي الفردي (انظر على سبيل المثال براءة الاختراع الأمريكية رقم 6،004،744) ، التسلسل المصغر ، تفاعل سلسلة ligase (LCR) (انظر على سبيل المثال Wu and Wallace، Genomics 4، 560 (1989)، Landegren et al.، Science 241، 1077 (1988)، تضخيم النسخ (Kwoh et al.، Proc. Natl. Acad. Sci. USA 86، 1173 (1989))، و تكرار التسلسل الذاتي (Guatelli et al.، Proc. Nat. Acad. Sci. USA، 87، 1874 (1990)) وتضخيم التسلسل المعتمد على الحمض النووي (NASBA). تشتمل طريقتا التضخيم الأخيرتان على تفاعلات متساوية الحرارة تعتمد على النسخ متساوي الحرارة ، والتي تنتج كلا من الحمض النووي الريبي المنفصل (ssRNA) و DNA مزدوج الشريطة (dsDNA) كمنتجات تضخيم بنسبة حوالي 30 أو 100 إلى 1 ، على التوالي.

يمكن أيضًا تشخيص الاضطراب المرتبط بفيروس السارس باستخدام جسم مضاد موجه ضد الحمض النووي لفيروس السارس أو تسلسل الأحماض الأمينية الذي يربط على وجه التحديد جزيء الحمض النووي أو عديد الببتيد. في نموذج بديل ، يمكن توجيه الجسم المضاد ضد بولي ببتيد SARS ، على سبيل المثال ، متعدد الببتيد S أو جزء منه الموجود على سطح فيريون SARS. طرق تحضير الأجسام المضادة أو لفحص ارتباط الجسم المضاد معروفة جيدًا في المجال.

قد يشمل التشخيص المصلي الكشف عن الأجسام المضادة ضد عديد ببتيد فيروس السارس أو جزيء الحمض النووي ، على سبيل المثال ، بروتين Nucleocapsid ، الذي يتم إنتاجه استجابة للعدوى باستخدام تقنيات مثل اختبار الأجسام المضادة الفلورية غير المباشرة أو مقايسات الممتز المناعي المرتبط بالإنزيم (ELISA). يمكن أيضًا تشخيص الاضطراب المرتبط بفيروس السارس عن طريق إجراء دراسات تهجين مسبار في الموقع على عينات الأنسجة على سبيل المثال.

في بعض الجوانب ، يمكن إجراء الاختبارات التشخيصية كما هو موصوف في هذه الوثيقة أو معروفة لأصحاب المهارة في الفن لمتغيرات فيروسات السارس التي تظهر إمراضية متزايدة ، مثل السلالات ذات التسلسلات الزائدة عن الحاجة.

في بعض النماذج ، يمكن توفير الكواشف للتشخيص (على سبيل المثال ، المجسات ، والبادئات ، والأجسام المضادة ، وما إلى ذلك) في مجموعات قد تتضمن اختياريًا تعليمات لاستخدام الكاشف أو قد تتضمن كواشف أخرى لإجراء الفحص المناسب ، على سبيل المثال ، الضوابط والمعايير والمخازن المؤقتة ، إلخ.

العلاج أو الوقاية من الاضطرابات المرتبطة بفيروس السارس

يمكن أيضًا استخدام المركبات وفقًا للاختراع لتوفير علاجات أو وقائية للاضطرابات المرتبطة بفيروس السارس. وفقًا لذلك ، يمكن استخدام هذه المركبات لعلاج أحد الثدييات ، على سبيل المثال ، الإنسان أو الحيوان المنزلي ، أو المزرعة ، أو الحيوانات البرية ، أو الحيوانات التجريبية التي لديها أو معرضة لخطر الإصابة باضطراب متعلق بفيروس السارس. قد تشمل هذه المركبات ، على سبيل المثال لا الحصر ، المركبات التي تتداخل مع تكاثر فيروس السارس ، أو التعبير عن بروتينات فيروس السارس ، أو قدرة فيروس السارس على إصابة خلية مضيفة. وفقًا لذلك ، في بعض النماذج ، يمكن استخدام المركبات التي تعمل كمضادات لعديد البيبتيدات لفيروس السارس كعلاجات أو وقائية للاضطرابات المرتبطة بفيروس السارس. في بعض النماذج ، يمكن استخدام عديد ببتيدات فيروسات سارس المنقى كمثبطات تنافسية لتعطيل الوظيفة الفيروسية. على سبيل المثال ، يمكن استخدام بروتين سبايك الذي يفتقر إلى مجال وظيفي ، أو لديه بعض التعديلات الأخرى التي تحافظ على الارتباط ولكنها تقلل أو تقضي على الإمراضية ، لتعطيل الوظيفة الفيروسية. في بعض النماذج ، يمكن استخدام الأجسام المضادة التي تربط عديد ببتيدات فيروس السارس أو جزيئات الحمض النووي ، على سبيل المثال ، الأجسام المضادة المتوافقة مع البشر كعلاجات أو وقائية.

في بعض النماذج ، يمكن استخدام مركبات فيروس سارس كلقاحات ، أو يمكن استخدامها لتطوير لقاحات. على سبيل المثال ، قد تكون الببتيدات المشتقة من أجزاء من بروتينات فيروس السارس أو عديد الببتيدات الموجودة على السطح الخارجي للفيريون أو سطح الخلية مفيدة للقاحات أو لتوليد أجسام مضادة علاجية أو وقائية.

"اللقاح" هو تركيبة تشتمل على مواد تثير الاستجابة المناعية المرغوبة. قد يختار اللقاح أو ينشط أو يوسع الذاكرة B و T خلايا الجهاز المناعي ، على سبيل المثال ، لتمكين القضاء على العوامل المعدية ، مثل فيروس السارس ، أو أحد مكوناته. في بعض النماذج ، يشتمل اللقاح على مادة حاملة مناسبة ، مثل المادة المساعدة ، وهي عامل يعمل بطريقة غير محددة لزيادة الاستجابة المناعية لمستضد معين ، أو لمجموعة من المستضدات ، مما يتيح تقليل كمية المستضد في أي جرعة لقاح معينة ، أو تقليل تكرار الجرعة المطلوبة لتوليد الاستجابة المناعية المرغوبة.

قد تشتمل اللقاحات وفقًا للاختراع على عديد ببتيدات فيروس السارس وجزيئات الحمض النووي الموصوفة هنا ، أو شظايا مولدة للمناعة منها. في بعض النماذج ، قد يكون فيروس سارس سبايك متعدد الببتيد ، أو متعدد ببتيد مغلف ، أو بروتين سكري غشائي أو شظايا منها مناسبًا لتطبيقات اللقاح. في بعض النماذج ، قد تكون اللقاحات متعددة التكافؤ وتشمل واحدة أو أكثر من حاتمة من عديد ببتيد فيروس سارس أو جزء منها.

في بعض تجسيدات الاختراع ، قد يشمل اللقاح كائنًا دقيقًا حيًا أو ميتًا مثل فيروس سارس أو أحد مكوناته. إذا تم استخدام فيروس سارس حي ، والذي يمكن إعطاؤه في شكل لقاح فموي ، فقد يحتوي على تعديلات جينية غير قابلة للرجوع (على سبيل المثال ، عمليات حذف كبيرة أو إدخال في التسلسل الجيني) التي تقلل أو تقضي على فوعة الفيروس ("الفيروس الموهن") ، ولكن ليس تحريضه على الاستجابة المناعية. في بعض التجسيدات ، قد يشتمل اللقاح الحي على كائن حي دقيق موهن غير سارس (على سبيل المثال ، بكتيريا أو فيروس مثل فيروس اللقاح) القادر على التعبير عن بولي ببتيد فيروس سارس أو جزء مناعي منه كما هو موصوف هنا. في بعض النماذج ، قد يشتمل اللقاح على عديد ببتيدات فيروس السارس أو جزيئات الحمض النووي التي لها تعديلات تسهل سهولة الإعطاء. على سبيل المثال ، يمكن استخدام بولي ببتيد فيروس سارس غير مهضوم أو جزيء حمض نووي للإعطاء عن طريق الفم ، ويمكن استخدام تعديل مناسب للاستنشاق للإعطاء إلى الرئة.

"لقاح الحمض النووي" أو "لقاح الحمض النووي" كما هو مستخدم في هذه الوثيقة ، عبارة عن بناء حمض نووي يشتمل على بولينيوكليوتيد يشفر مولد ضد متعدد الببتيد ، خاصة حمض أميني مستضد تم تحديده بواسطة طرق موصوفة هنا أو معروفة في الفن. يمكن أن تشتمل بنية الحمض النووي أيضًا على عناصر محفز نسخية ، وعناصر مُحسِّن ، وإشارات ربط ، وإشارات إنهاء وإشارات تعدد الأدينيل ، وتسلسلات حمض نووي أخرى. وبالتالي ، يتم إدخال لقاح الحمض النووي بشكل عام في حيوان خاضع له باستخدام على سبيل المثال واحد أو أكثر من بلازميدات الحمض النووي بما في ذلك واحد أو أكثر من متواليات ترميز مستضد (على سبيل المثال ، بولي ببتيد مغلف فيروسات سارس أو تسلسل بروتين سكري غشائي) القادر على نقل الخلايا في الجسم الحي وتحفيز الاستجابة المناعية (انظر على سبيل المثال Whalen RG et al. التحصين بوساطة الحمض النووي والاستجابة المناعية النشطة لمستضد سطح التهاب الكبد B.. Clin Immunol Immunopathol 1995 75: 1-12 Wolff JA et al. النقل المباشر للجينات إلى عضلات الفأر في الجسم الحي. Science 1990 247: 1465-8 Fynan EF et al. لقاحات الحمض النووي: التطعيمات الوقائية عن طريق التطعيمات الأبوية والمخاطية والجينية. Proc Natl Acad Sci USA 1993 90: 11478-82). في بعض النماذج ، يمكن تحضير مكتبة من شظايا الحمض النووي عن طريق استنساخ الحمض النووي الجيني لفيروس السارس إلى ناقل تعبير بلازميد باستخدام التقنيات المعروفة ، ثم تستخدم المكتبة كلقاح للحمض النووي (انظر على سبيل المثال Barry MA ، وآخرون. الحماية من الميكوبلازما العدوى باستخدام التحصين مكتبة التعبير. Nature 1995 377: 632-5).

يتم إعطاء المريض لقاح الحمض النووي باستخدام الطرق القياسية. يمكن إعطاء الفقاريات بالحقن ، أو تحت الجلد ، أو عن طريق الوريد ، أو داخل الصفاق ، أو داخل الجلد ، أو عضليًا ، أو موضعيًا ، أو عن طريق الفم ، أو الشرج ، أو الأنف ، أو الفم ، أو المهبل ، أو عن طريق الاستنشاق ، أو عن طريق خزان مزروع في تركيبات جرعات تحتوي على ناقلات تقليدية غير سامة ومقبولة من الناحية الفسيولوجية أو المركبات. بدلا من ذلك ، يتم إعطاء المريض لقاح الحمض النووي من خلال استخدام أداة تسريع الجسيمات أو القصف ("بندقية الجينات"). يعتمد الشكل الذي يتم تناوله به (على سبيل المثال ، كبسولة ، قرص ، محلول ، مستحلب) جزئيًا على طريقة تناوله. على سبيل المثال ، يمكن استخدام قطرات الأنف أو المستنشقات أو التحاميل للإعطاء المخاطي. يمكن إعطاء لقاح الحمض النووي جنبًا إلى جنب مع المواد المساعدة المعروفة. يتم إعطاء المادة المساعدة بكمية كافية ، وهي تلك الكمية الكافية لتوليد استجابة مناعية معززة للقاح الحمض النووي. يمكن إعطاء المادة المساعدة قبل (على سبيل المثال ، يوم واحد أو أكثر قبل) التلقيح بلقاح الحمض النووي بالتزامن مع (على سبيل المثال ، خلال 24 ساعة من) التلقيح بلقاح الحمض النووي بالتزامن (في وقت واحد) مع لقاح الحمض النووي (على سبيل المثال ، يتم خلط المادة المساعدة مع لقاح الحمض النووي ، ويتم إعطاء الخليط للفقاريات) أو بعد (على سبيل المثال ، يوم أو أكثر بعد) التلقيح بلقاح الحمض النووي. يمكن أيضًا إعطاء المادة المساعدة أكثر من مرة (على سبيل المثال ، قبل التلقيح بلقاح الحمض النووي وأيضًا بعد التلقيح بلقاح الحمض النووي). كما هو مستخدم هنا ، يشمل المصطلح "بالاقتران مع" أي فترة زمنية ، بما في ذلك تلك الموصوفة تحديدًا هنا ومجموعات الفترات الزمنية الموصوفة تحديدًا هنا ، والتي يمكن خلالها إعطاء المادة المساعدة لتوليد استجابة مناعية معززة للحمض النووي لقاح (على سبيل المثال ، زيادة عيار الجسم المضاد للمستضد المشفر بواسطة لقاح الحمض النووي ، أو زيادة عيار الجسم المضاد للعامل الممرض). يمكن إعطاء اللقاح المساعد ولقاح الحمض النووي في نفس الموقع تقريبًا على الفقاريات على سبيل المثال ، يتم إعطاء كل من اللقاح المساعد ولقاح الحمض النووي في موقع محدد على أحد أطراف المريض.

في بعض التجسيدات ، قد يتم منع أو منع التعبير عن جين فيروس سارس أو منطقة مشفرة أو غير مشفرة ذات أهمية باستخدام تقنية تداخل الحمض النووي الريبي (RNAi) ، وهو نوع من إسكات الجينات بعد النسخ. يمكن استخدام RNAi لإنشاء "ضربة قاضية" وظيفية ، أي نظام يتم فيه تقليل التعبير عن الجين أو منطقة الترميز أو غير المشفرة ذات الأهمية ، مما يؤدي إلى تقليل إجمالي للمنتج المشفر. على هذا النحو ، يمكن إجراء RNAi لاستهداف حمض نووي ذي فائدة أو جزء منه أو متغير منه ، لتقليل تعبيره ومستوى نشاط المنتج الذي يشفره. يمكن استخدام مثل هذا النظام للعلاج أو الوقاية ، وكذلك للدراسات الوظيفية. تم وصف RNAi على سبيل المثال في طلبات براءات الاختراع الأمريكية المنشورة رقم 20020173478 (نشر Gewirtz في 21 نوفمبر 2002) و 20020132788 (لويس وآخرون. نُشر في 7 نوفمبر 2002). الكواشف والأطقم الخاصة بأداء RNAi متاحة تجاريًا على سبيل المثال Ambion Inc. (Austin، Tex.، USA) و New England Biolabs Inc. (Beverly، Mass.، USA).

يُعتقد أن العامل الأولي لـ RNAi في بعض الأنظمة هو جزيء dsRNA المقابل للحمض النووي المستهدف. يُعتقد بعد ذلك أن الرنا المزدوج الجديلة ينقسم إلى رنا قصيرة متداخلة (siRNAs) والتي يبلغ طولها 21-23 نيوكليوتيدات (19-21 زوجًا قاعديًا مزدوجًا ، كل منها به 2 نيوكليوتيد 3). تمت الإشارة إلى الإنزيم الذي يُعتقد أنه يؤثر على خطوة الانقسام الأولى هذه باسم "Dicer" ويتم تصنيفها كعضو في عائلة Rnase III من ribonucleases الخاص بـ dsRNA. بدلاً من ذلك ، يمكن أن يتأثر RNAi عن طريق الإدخال المباشر للخلية ، أو التوليد داخل الخلية عن طريق إدخال سلائف مناسبة في الخلية (مثل ناقل ، إلخ) لجزيء siRNA أو جزيء يشبه siRNA. قد يرتبط siRNA بعد ذلك بمكونات أخرى داخل الخلايا لتشكيل معقد إسكات يسببه الحمض النووي الريبي (RISC). قد يستهدف RISC الذي تم تشكيله على هذا النحو لاحقًا نسخة من الاهتمام عبر تفاعلات اقتران القاعدة بين مكون siRNA الخاص به والنسخة المستهدفة بحكم التناظر ، مما أدى إلى انقسام النسخة المستهدفة تقريبًا من 12 نيوكليوتيد من نهاية 3 من siRNA. وهكذا يتم شق الرنا المرسال المستهدف ويتم تقليل مستوى منتج البروتين الذي يشفره.

يمكن أن يتأثر RNAi بإدخال سيرنا مناسب في المختبر أو جزيئات تشبه سيرنا في الخلايا. يمكن على سبيل المثال إجراء RNAi باستخدام RNA المركب كيميائيًا ، حيث يمكن تصنيع جزيئات RNA المناسبة كيميائيًا باستخدام طرق معروفة. بدلاً من ذلك ، يمكن استخدام نواقل التعبير المناسبة لنسخ مثل هذا الحمض النووي الريبي إما في المختبر أو في الجسم الحي. يمكن إجراء النسخ المختبر لخيوط الإحساس ومضادات المعنى (المشفرة بواسطة متواليات موجودة على نفس المتجه أو على نواقل منفصلة) باستخدام على سبيل المثال بوليميريز T7 RNA ، وفي هذه الحالة قد يشتمل المتجه على تسلسل تشفير مناسب مرتبط عمليًا بمحفز T7 . قد تتم معالجة الحمض النووي الريبي المنسوخ في المختبر في النماذج (على سبيل المثال باستخدام بكتريا قولونية RNase III) في المختبر بحجم يفضي إلى RNAi. تم دمج نصوص المعنى والمضاد المعنى لتشكيل RNA مزدوجًا يتم إدخاله في الخلية المستهدفة ذات الأهمية. يمكن استخدام نواقل أخرى ، والتي تعبر عن RNAs صغير دبوس الشعر (shRNAs) والتي يمكن معالجتها في جزيئات تشبه سيرنا. طرق مختلفة تعتمد على المتجهات معروفة في الفن. طرق مختلفة لإدخال مثل هذه النواقل في الخلايا ، إما في المختبر أو في الجسم الحي (مثل العلاج الجيني) معروفة في المجال.

وفقًا لذلك ، في أحد النماذج ، قد يتم منع التعبير عن بولي ببتيد متضمنًا تسلسل حمض أميني مطابق إلى حد كبير لتسلسل فيروس سارس عن طريق إدخال أو توليد داخل خلية سيرنا أو جزيء شبيه سيرنا مطابق لجزيء حمض نووي يشفر عديد ببتيد أو شظية منها أو إلى حمض نووي مماثل لها. في تجسيدات مختلفة ، قد تستلزم مثل هذه الطريقة الإدارة المباشرة لـ siRNA أو جزيء شبيه بـ siRNA في خلية ، أو استخدام الطرق القائمة على النواقل الموضحة أعلاه. في أحد النماذج ، يكون طول الجزيء المشابه لـ siRNA أو siRNA أقل من حوالي 30 نيوكليوتيد. في نموذج إضافي ، يبلغ طول جزيئات siRNA أو الجزيئات الشبيهة بـ siRNA حوالي 21-23 نيوكليوتيد. في أحد النماذج ، تشتمل جزيئات siRNA أو جزيئات تشبه siRNA وجزء مزدوج 19-21 زوج قاعدي ، كل حبلا به 2 نيوكليوتيد 3 متدلية. في النماذج ، يكون جزيء siRNA أو الجزيء الشبيه بـ siRNA مطابقًا إلى حد كبير للحمض النووي الذي يشفر متعدد الببتيد أو جزء أو متغير (أو جزء من متغير) منه. مثل هذا المتغير قادر على ترميز بروتين له نشاط متعدد الببتيد لفيروس السارس. في النماذج ، يكون خيط الإحساس لجزيء siRNA أو جزيء يشبه siRNA متطابقًا إلى حد كبير مع جزيء الحمض النووي لفيروس SARS أو جزء منه (يحتوي RNA على U بدلاً من T بقايا من تسلسل DNA).

تعبير بروتين فيروس السارس

بشكل عام ، يمكن إنتاج عديد ببتيدات فيروس السارس وفقًا للاختراع عن طريق تحويل خلية مضيفة مناسبة مع كل أو جزء من جزيء جينومي أو جزيء cDNA مشفر لفيروس السارس أو جزء منه (على سبيل المثال ، DNA الجيني أو cDNAs الموصوفة هنا) في وسيلة تعبير مناسبة. سوف يفهم أولئك المهرة في مجال البيولوجيا الجزيئية أن أيًا من مجموعة متنوعة من أنظمة التعبير يمكن استخدامها لتوفير البروتين المؤتلف. الخلية المضيفة الدقيقة المستخدمة ليست حاسمة بالنسبة للاختراع. يمكن إنتاج عديد ببتيد فيروس السارس في مضيف بدائية النواة (على سبيل المثال ، بكتريا قولونية أو فيروس ، على سبيل المثال ، فيروس كورون مثل OC43 أو 229E البشري ، أو فيروس كورونا البقري ، أو فيروس يستخدم للعلاج الجيني ، مثل الفيروس الغدي) أو في مضيف حقيقي النواة (على سبيل المثال ، خميرة الخميرة، خلايا الحشرات ، على سبيل المثال ، خلايا Sf21 ، أو خلايا الثدييات ، على سبيل المثال ، خلايا COS 1 أو NIH 3T3 أو VeroE6 أو خلايا هيلا). تتوفر هذه الخلايا من مجموعة واسعة من المصادر (على سبيل المثال ، American Type Culture Collection ، Rockland ، Md. أيضًا ، انظر ، على سبيل المثال ، Ausubel et al. ، البروتوكولات الحالية في البيولوجيا الجزيئية ، John Wiley & amp Sons ، New York ، 1994) . تعتمد طريقة التحويل أو تعداء واختيار وسيلة التعبير على النظام المضيف المحدد. تم وصف طرق التحويل وترنسفكأيشن ، على سبيل المثال ، في Ausubel et al. يمكن اختيار مركبات التعبير (أعلاه) من تلك المتوفرة ، على سبيل المثال ، في Cloning Vectors: A Laboratory Manual ، P. H. Pouwels et al ، 1985 ، Supp. 1987) ، أو من المصادر المتاحة تجاريًا. نماذج حيوانية مناسبة ، على سبيل المثال يمكن استخدام نموذج حيواني النمس ، أو أي نموذج حيواني آخر مناسب لتحليل عدوى فيروس السارس أو التعبير عن جزيئات الحمض النووي لفيروس السارس.

في نموذج بديل ، يمكن استخدام نظام التعبير عن الفيروس البكتيري (باستخدام ، على سبيل المثال ، ناقل pBacPAK9) المتاح من Clontech (Pal Alto ، كاليفورنيا). إذا رغبت في ذلك ، يمكن استخدام هذا النظام بالاقتران مع تقنيات التعبير عن البروتين الأخرى ، على سبيل المثال ، طريقة علامة myc التي وصفها Evan et al. (Mol. Cell Biol.5: 3610-3616 ، 1985). في نموذج بديل ، يمكن إنتاج بولي ببتيد فيروسات سارس بواسطة خط خلية ثديي منقوص بثبات. يتوفر عدد من النواقل المناسبة لترنسفكأيشن مستقر لخلايا الثدييات للجمهور ، على سبيل المثال ، انظر طرق Pouwels et al (أعلاه) لبناء مثل هذه الخطوط الخلوية متاحة للجمهور ، على سبيل المثال ، في Ausubel et al. (أعلاه). في أحد الأمثلة ، يتم استنساخ (كدنا) الذي يشفر بولي ببتيد فيروس السارس في ناقل تعبير يتضمن جين اختزال ثنائي هيدروفولات (DHFR). يتم اختيار تكامل البلازميد ، وبالتالي ، جين ترميز عديد الببتيد لفيروس السارس في كروموسوم الخلية المضيفة من خلال تضمين 0.01-300 ميكرومتر ميثوتريكسات في وسط زراعة الخلية (كما هو موضح في Ausubel et al. ، أعلاه). يمكن تحقيق هذا التحديد السائد في معظم أنواع الخلايا. يمكن زيادة تعبير البروتين المؤتلف عن طريق تضخيم الجين المنقول بوساطة DHFR. تم وصف طرق اختيار خطوط الخلايا التي تحمل تضخمات الجينات في Ausubel et al. (أعلاه) تتضمن هذه الطرق عمومًا زراعة ممتدة في وسط يحتوي على مستويات متزايدة تدريجياً من الميثوتريكسات. تشمل نواقل التعبير المحتوية على DHFR التي يشيع استخدامها لهذا الغرض pCVSEII-DHFR و pAdD26SV (A) (الموصوفة في Ausubel et al. ، أعلاه). أي من الخلايا المضيفة الموصوفة أعلاه أو ، بشكل مفضل ، خط خلية CHO الذي يعاني من نقص DHFR (على سبيل المثال ، CHO DHFR.sup.- الخلايا ، ATCC Accession No. CRL 9096) هي من بين الخلايا المضيفة المفضلة لاختيار DHFR لمجموعة منقولة بشكل ثابت خط الخلية أو تضخيم الجينات بوساطة DHFR.

بمجرد التعبير عن بولي ببتيد فيروس السارس المؤتلف ، يتم عزله ، على سبيل المثال ، باستخدام كروماتوجرافيا التقارب. في أحد الأمثلة ، قد يتم إرفاق جسم مضاد متعدد الببتيد لفيروس السارس (على سبيل المثال ، تم إنتاجه كما هو موصوف هنا) بعمود ويستخدم لعزل بولي ببتيد فيروس السارس. يمكن إجراء تحلل وتجزئة الخلايا التي تأوي عديد الببتيد لفيروس السارس قبل التحليل اللوني للألفة بالطرق القياسية (انظر ، على سبيل المثال ، Ausubel et al. ، أعلاه). في مثال آخر ، يمكن تنقية بولي ببتيدات فيروس السارس أو تنقيته إلى حد كبير من خليط من المركبات مثل مستخلص أو مادة طافية تم الحصول عليها من الخلايا (Ausubel et al. ، أعلاه). يمكن استخدام تقنيات التنقية القياسية للتخلص التدريجي من المركبات غير المرغوب فيها من الخليط حتى يتم عزل مركب واحد أو أقل عدد من المركبات الفعالة.

بمجرد عزل البروتين المؤتلف ، يمكن ، إذا رغبت في ذلك ، تنقيته بشكل أكبر ، على سبيل المثال ، عن طريق كروماتوجرافيا سائلة عالية الأداء (انظر ، على سبيل المثال ، فيشر ، تقنيات المختبر في الكيمياء الحيوية والبيولوجيا الجزيئية ، محرران ، وورك وبوردون ، إلسفير ، 1980).

يمكن أيضًا إنتاج عديد الببتيدات الخاصة بالاختراع ، خاصة شظايا ببتيد فيروس سارس القصيرة ، عن طريق التخليق الكيميائي (على سبيل المثال ، بالطرق الموضحة في تخليق الببتيد في المرحلة الصلبة ، الطبعة الثانية ، 1984 The Pierce Chemical Co.، Rockford، Ill.).

يمكن أيضًا استخدام هذه التقنيات العامة لتعبير وتنقية عديد الببتيد لإنتاج وعزل شظايا بروتين فيروس سارس أو نظائرها المفيدة (الموصوفة هنا).

في تجسيدات بديلة معينة ، قد يكون متعدد ببتيد السارس قد أرفق أيًا من مجموعة متنوعة من العلامات. يمكن أن تكون العلامات علامات للأحماض الأمينية أو علامات كيميائية ويمكن إضافتها لغرض التنقية (على سبيل المثال علامة 6-هيستيدين للتنقية فوق عمود من النيكل). في تجسيدات مفضلة أخرى ، يمكن استخدام ملصقات متنوعة كوسيلة لاكتشاف ارتباط بولي ببتيد SARS بعديد ببتيد آخر ، على سبيل المثال بمستقبل سطح الخلية. وبدلاً من ذلك ، يمكن تسمية السارس DNA أو RNA للكشف ، على سبيل المثال في مقايسة التهجين. يمكن تمييز الأحماض النووية أو البروتينات لفيروس السارس ، أو مشتقاتها ، بشكل مباشر أو غير مباشر ، على سبيل المثال ، باستخدام منظار إشعاعي ، أو مركب فلوري ، أو مركب مضيء بيولوجي ، أو مركب كيميائي ، أو مخلّب معدني أو إنزيم. أولئك الذين يتمتعون بمهارة عادية في الفن سيعرفون العلامات المناسبة الأخرى أو سيكونون قادرين على التأكد من ذلك ، باستخدام التجارب الروتينية. في تجسيد آخر للاختراع ، ترتبط polypeptides التي تم الكشف عنها هنا ، أو مشتقاتها ، بالسموم.

عزل وتحديد جزيئات فيروس السارس الإضافية

استنادًا إلى تسلسل فيروس السارس الموصوف هنا ، أصبح من الممكن عزل وتحديد التسلسلات الإضافية المتعلقة بفيروس السارس مثل جينات فيروس السارس وسلالات أو عزلات فيروس السارس الإضافية باستخدام التقنيات القياسية. بالإضافة إلى ذلك ، توفر تسلسلات فيروسات السارس المقدمة هنا أيضًا الأساس لتعريف المتواليات المتماثلة من الأنواع الأخرى والأجناس من بدائيات النوى وحقيقيات النوى مثل الفيروسات والبكتيريا والفطريات والطفيليات والخميرة و / أو الثدييات. في بعض النماذج ، يمكن استخدام متواليات الحمض النووي الموصوفة هنا لتصميم مجسات أو بادئات ، بما في ذلك تحقيقات أو بادئات قليلة النوكليوتيد المتحللة ، بناءً على تسلسل أي من خيط DNA. يمكن بعد ذلك استخدام المجسات أو البادئات لفحص مكتبات الجينوم أو cDNA للتسلسلات من على سبيل المثال المتغيرات التي تحدث بشكل طبيعي أو عزلات فيروسات السارس ، باستخدام التضخيم القياسي أو تقنيات التهجين.

في بعض النماذج ، يمكن تحديد شركاء الربط عن طريق تمييز البولي ببتيدات للاختراع (على سبيل المثال ، تلك المتطابقة إلى حد كبير مع عديد ببتيدات فيروس السارس الموصوفة هنا) مع تسلسل حاتمة (على سبيل المثال ، FLAG أو 2HA) ، وتسليمها إلى الخلايا المضيفة ، إما عن طريق تعداء مع ناقل مناسب يحتوي على تسلسل حمض نووي يشفر عديد ببتيد من الاختراع ، متبوعًا بالترسيب المناعي وتحديد الشريك الملزم. قد تصاب الخلايا بالسلالات التي تعبر عن اندماج FLAG أو 2HA ، يليها تحلل وترسيب مناعي بأجسام مضادة لـ FLAG أو مضادات 2HA. يمكن تحديد شركاء الربط عن طريق التحليل الطيفي الشامل. إذا لم يتم إنتاج البولي ببتيد الخاص بالاختراع بكميات كافية ، فقد لا تقدم هذه الطريقة بروتينًا مميزًا كافيًا لتحديد شريكه. كجزء من نهج تكميلي ، يمكن استنساخ كل بولي ببتيد من الاختراع في ناقل انتقال للثدييات مدمج ، على سبيل المثال ، 2HA و GFP و / أو FLAG. بعد ترنسفكأيشن ، يمكن أن تتحلل خلايا هيلا ويؤثر على مناعة عديد الببتيد الموسومة. يمكن تحديد شريك الربط بواسطة SDS PAGE متبوعًا بالتحليل الطيفي الشامل.

في بعض النماذج ، يمكن تمييز البولي ببتيدات أو الأجسام المضادة الخاصة بالاختراع وإنتاجها واستخدامها على سبيل المثال في أعمدة التقارب و / أو في المقايسات المناعية لتحديد و / أو تأكيد المركبات المستهدفة المحددة. يمكن استخدام البروتينات FLAG و HA و / أو الخاصة به لأعمدة التقارب هذه لسحب عوامل الخلية المضيفة من مستخلصات الخلية ، ويمكن التحقق من صحة أي نتائج من خلال فحوصات الربط القياسية ومنحنيات التشبع والطرق الأخرى كما هو موضح هنا أو معروف لـ أصحاب المهارة في الفن.

في بعض النماذج ، يمكن استخدام نظام هجينين لدراسة تفاعلات البروتين-البروتين. يمكن استنساخ متواليات الحمض النووي الموصوفة هنا ، أو المتواليات المتطابقة معها إلى حد كبير ، في بلازميد طعم pBT للنظامين الهجينين ، ويمكن استخدام مكتبة طحال مورين متوفرة تجارياً مؤلفة من 5 × 10 6 نسخ مستقلة ، كمكتبة مستهدفة لـ الطعوم. يمكن وصف الضربات المحتملة أيضًا عن طريق استعادة البلازميدات وإعادة التحويل لتقليل الإيجابيات الزائفة الناتجة عن متغيرات الطعم النسيلي والنسخ المستهدفة للمكتبة التي تنشط جينات المراسل بشكل مستقل عن الطعم المستنسخ. يمكن دراسة الضربات القابلة للتكرار بشكل أكبر كما هو موضح هنا.

يمكن قياس الفوعة كما هو موصوف هنا أو كما هو معروف لأصحاب المهارة في المجال. بمجرد تحديد متواليات التشفير ، يمكن عزلها باستخدام تقنيات الاستنساخ القياسية ، وإدراجها في أي ناقل أو نسخ متماثل مناسب ، على سبيل المثال ، لإنتاج بولي ببتيدات. تشمل هذه النواقل والنسخ المتماثلة ، على سبيل المثال لا الحصر ، العاثية X (بكتريا قولونية) ، pBR322 (بكتريا قولونية) ، pACYC177 (بكتريا قولونية) ، pKT230 (بكتيريا سالبة الجرام) ، pGV1106 (بكتيريا سالبة الجرام) ، pLAFR1 (بكتيريا سالبة الجرام) ، pME290 (غير-بكتريا قولونية البكتيريا سالبة الجرام) ، pHV14 (بكتريا قولونية و العصوية الرقيقة) ، pBD9 (عصية) ، pIJ61 (ستربتوميسيس) ، pUC6 (ستربتوميسيس) ، YIp5 (السكريات) ، YCp19 (السكريات) أو فيروس الورم الحليمي البقري (خلايا الثدييات). بشكل عام ، يمكن إنتاج البولي ببتيدات من الاختراع في أي خلية مضيفة مناسبة محولة أو منقولة بواسطة ناقل مناسب. تعتمد طريقة التحويل أو تعداء واختيار وسيلة التعبير على النظام المضيف المحدد. يمكن استخدام مجموعة متنوعة من أنظمة التعبير ، والخلية المضيفة الدقيقة المستخدمة ليست بالغة الأهمية للاختراع. على سبيل المثال ، يمكن إنتاج بولي ببتيد وفقًا للاختراع في مضيف بدائية النواة (على سبيل المثال ، بكتريا قولونية) أو في مضيف حقيقي النواة (على سبيل المثال ، Saccharoinyces cerevisiae، خلايا الحشرات ، على سبيل المثال ، خلايا Sf21 ، أو خلايا الثدييات ، على سبيل المثال ، خلايا المعاهد الوطنية للصحة 3T3 ، هيلا ، أو خلايا كوس). تتوفر هذه الخلايا من مجموعة واسعة من المصادر (على سبيل المثال ، American Type Culture Collection ، Manassus ، Va.). تشمل أنظمة التعبير البكتيرية لإنتاج عديد الببتيد بكتريا قولونية نظام تعبير pET (Novagen، Inc.، Madison، Wis.) ونظام التعبير pGEX (فارماسيا).

في أحد الجوانب ، تشتمل المركبات وفقًا للاختراع على جزيئات الحمض النووي وعديد البيبتيدات لفيروس السارس ، مثل المتواليات التي تم الكشف عنها في الأشكال والجداول هنا ، وفي جميع المواصفات ، وشظايا منها. في نماذج بديلة ، يمكن أن تكون المركبات وفقًا للاختراع عبارة عن جزيئات حمض نووي يبلغ طولها 10 نيوكليوتيدات على الأقل ، والتي يتم اشتقاقها من المتواليات الموصوفة هنا. في نماذج بديلة ، يمكن أن تكون المركبات وفقًا للاختراع عبارة عن ببتيدات يكون طولها على الأقل 5 أحماض أمينية ، والتي يتم اشتقاقها من المتواليات الموصوفة هنا.

في نماذج بديلة ، يمكن أن يكون المركب وفقًا للاختراع عبارة عن جزيء غير ببتيد بالإضافة إلى نظير ببتيد أو ببتيد. سيكون نظير الببتيد أو الببتيد بشكل عام صغيرًا بقدر الإمكان مع الاحتفاظ بالنشاط البيولوجي الكامل. يمكن أن يكون الجزيء غير الببتيد أي جزيء يُظهر نشاطًا بيولوجيًا كما هو موصوف هنا أو معروفًا في المجال. يمكن قياس النشاط البيولوجي ، على سبيل المثال ، من حيث القدرة على إثارة استجابة سامة للخلايا ، أو التوسط في تكرار الحمض النووي ، أو أي وظيفة أخرى لجزيء فيروس السارس.

يمكن تحضير المركبات عن طريق ، على سبيل المثال ، استبدال أو حذف أو إدخال بقايا حمض أميني من ببتيد السارس أو نظير الببتيد ، كما هو موصوف هنا ، مع بقايا الأحماض الأمينية المحافظة الأخرى ، على سبيل المثال ، البقايا التي لها خصائص فيزيائية أو بيولوجية أو كيميائية مماثلة ، والكشف عن الوظيفة البيولوجية.

من المعروف جيدًا في المجال أنه يمكن إجراء بعض التعديلات والتغييرات في بنية عديد ببتيد دون إجراء تغيير جوهري في الوظيفة البيولوجية لذلك الببتيد ، للحصول على بولي ببتيد مكافئ بيولوجيًا. يمكن إجراء هذه التعديلات لغرض تعديل الوظيفة ، أو لتسهيل الإدارة أو تعزيز الاستقرار أو منع الانهيار ، على سبيل المثال ، الاستخدامات العلاجية. على سبيل المثال ، يمكن استخدام مركب فيروس SARS غير قابل للهضم وفقًا للاختراع للإعطاء عن طريق الفم ، ويمكن استخدام تعديل مناسب للاستنشاق للإعطاء إلى الرئة أو قد يؤدي إضافة تسلسل قيادي إلى زيادة مستويات التعبير البروتيني.

في أحد جوانب الاختراع ، قد تشتمل الببتيدات أو الحواتم المشتقة من فيروس السارس على ببتيدات تختلف عن جزء من متوالية محلية أو بروتين أو فيروس سارس عن طريق بدائل الأحماض الأمينية المحافظة. تمتد أيضًا الببتيدات والحواتم الخاصة بالاختراع الحالي إلى الببتيدات المكافئة بيولوجيًا والتي تختلف عن جزء من تسلسل الببتيدات الجديدة للاختراع الحالي عن طريق بدائل الأحماض الأمينية المحافظة. كما هو مستخدم هنا ، يشير المصطلح "بدائل الأحماض الأمينية المحفوظة" إلى استبدال حمض أميني بآخر في موقع معين في الببتيد ، حيث يمكن إجراء الاستبدال دون خسارة كبيرة في الوظيفة ذات الصلة. عند إجراء مثل هذه التغييرات ، يمكن إجراء بدائل لمخلفات الأحماض الأمينية المماثلة على أساس التشابه النسبي لبدائل السلسلة الجانبية ، على سبيل المثال ، حجمها وشحنتها ومقاومتها للماء وقابليتها للماء وما شابه ، ويمكن تقييم هذه البدائل من أجلها. تأثير على وظيفة الببتيد عن طريق الاختبار الروتيني.

في بعض النماذج ، يمكن عمل بدائل الأحماض الأمينية المحفوظة حيث يتم استبدال بقايا حمض أميني بآخر له نفس القيمة المحبة للماء (على سبيل المثال ، ضمن قيمة زائد أو ناقص 2.0) ، حيث يمكن أن يكون ما يلي حمض أميني له تأثير مائي يتم تعيين فهرس يبلغ حوالي −1.6 مثل Tyr (−1.3) أو Pro (−1.6) s لبقايا الأحماض الأمينية (على النحو المفصل في براءة الاختراع الأمريكية رقم 4،554،101 ، مدمجة هنا بالرجوع): Arg (+3.0) Lys (+ 3.0) Asp (+3.0) Glu (+3.0) Ser (+0.3) Asn (+0.2) Gln (+0.2) Gly (0) Pro (−0.5) Thr (−0.4) Ala (−0.5) صاحب (−0.5) ) Cys (−1.0) Met (−1.3) Val (−1.5) Leu (−1.8) Ile (−1.8) Tyr (−2.3) Phe (−2.5) و Trp (−3.4).

في نماذج بديلة ، يمكن عمل بدائل الأحماض الأمينية المحفوظة حيث يتم استبدال بقايا حمض أميني بآخر له مؤشر مائي مماثل (على سبيل المثال ، ضمن قيمة زائد أو ناقص 2.0). في مثل هذه النماذج ، يمكن تعيين مؤشر مائي لكل بقايا من الأحماض الأمينية على أساس قدرتها على مقاومة الماء وخصائص الشحن ، على النحو التالي: Ile (+4.5) Val (+4.2) Leu (+3.8) Phe (+2.8) Cys (+ 2.5) Met (+1.9) Ala (+1.8) Gly (−0.4) Thr (−0.7) Ser (−0.8) Trp (−0.9) Tyr (−1.3) Pro (−1.6) His (−3.2) Glu (- 3.5) Gln (−3.5) Asp (−3.5) Asn (−3.5) Lys (−3.9) و Arg (−4.5).

في نماذج بديلة ، يمكن عمل بدائل الأحماض الأمينية المحفوظة حيث يتم استبدال بقايا حمض أميني بآخر في نفس الفئة ، حيث يتم تقسيم الأحماض الأمينية إلى فئات غير قطبية ، وحمضية ، وقاعدة ، ومحايدة ، على النحو التالي: غير قطبي: Ala، Val، Leu، Ile، Phe، Trp، Pro، Met حامضي: Asp، Glu basic: Lys، Arg، محايد: Gly، Ser، Thr، Cys، Asn، Gln، Tyr.

يمكن أن تشمل التغييرات الحافظة للأحماض الأمينية استبدال حمض أميني L بحمض أميني D المقابل ، أو بحمض أميني D محافظ ، أو بشكل طبيعي غير مشفر وراثيًا من الأحماض الأمينية ، وكذلك الاستبدال المحافظ للحمض الأميني L. تشمل الأحماض الأمينية غير المشفرة جينيا بشكل طبيعي بيتا ألانين ، 3-حمض أميني بروبيونيك ، 2،3-ديامينو بروبيونيك ، حمض ألفا أمينوبوتريك ، 4-أمينو-حمض الزبد ، N-methylglycine (ساركوزين) ، هيدروكسي برولين ، أورنيثين ، سيترولين ، تي-بوتيل ألانين ، تي بوتيل جليسين ، N- ميثيل أيسولوسين ، فينيل جليسين ، سيكلوهكسيل ألانين ، نورليوسين ، نورفالين ، 2-نابثيل ألانين ، بيريديل ألانين ، 3-بنزوثينيل ألانين ، 4-كلوروفين ألانين ، البنسيلامين ، 1،2،3،4-رباعي هيدرو-إيزوكينولين -3-كاربوكسيلكس أسيد ، بيتا 2-ثينيل ألانين ، ميثيونين سلفوكسيد ، هوموارجينين ، N-acetyl lysine ، 2-amino butyric acid ، 2-amino butyric acid ، 2 ، 4 ، -حمض أمينو الزبد ، p-aminophenylalanine ، N-methylvaline ، homocysteine ​​، homoserine ، cysteic acid ، epsilon-amino hexanoic acid ، delta-amino valeric acid ، أو 2.3-diaminobutyric acid.

في تجسيدات بديلة ، تشتمل تغييرات الأحماض الأمينية المحافظة على تغييرات بناءً على اعتبارات المحبة للماء أو كره الماء ، أو الحجم أو الحجم ، أو الشحنة.يمكن وصف الأحماض الأمينية عمومًا بأنها كارهة للماء أو محبة للماء ، اعتمادًا بشكل أساسي على خصائص السلسلة الجانبية للأحماض الأمينية. يُظهِر الحمض الأميني الكاره للماء نفاذية للماء أكبر من الصفر ، ويُظهر الحمض الأميني المحب للماء درجة محبة للماء أقل من الصفر ، بناءً على مقياس إجماع الكراهية للماء الخاص بـ Eisenberg et aL (جيه مول. السيرة الذاتية. 179: 125-142 ، 184). تشمل الأحماض الأمينية الكارهة للماء المشفرة وراثيًا Gly و Ala و Phe و Val و Leu و Ile و Pro و Met و Trp ، وتشمل الأحماض الأمينية المحبة للماء المشفرة وراثيًا Thr و His و Glu و Gln و Asp و Arg و Ser و Lys. تشتمل الأحماض الأمينية الكارهة للماء غير المشفرة وراثيًا على تي بيوتيل ألانين ، بينما تشتمل الأحماض الأمينية المحبة للماء غير المشفرة وراثيًا على سيترولين وهوموسيستين.

يمكن تقسيم الأحماض الأمينية الكارهة للماء أو المحبة للماء بشكل أكبر بناءً على خصائص سلاسلها الجانبية. على سبيل المثال ، الحمض الأميني العطري هو حمض أميني كاره للماء مع سلسلة جانبية تحتوي على الأقل حلقة عطرية أو غير متجانسة ، والتي قد تحتوي على واحد أو أكثر من البدائل مثل - OH ، - SH ، --CN ، - F ، - Cl ، - Br ، - أنا ، - لا2، -غير ح2، -NHR ، -NRR ، -C (O) R ، -C (O) OH ، -C (O) أو ، -C (O) NH2، —C (O) NHR ، —C (O) NRR ، وما إلى ذلك ، حيث يكون R بشكل مستقل (C16) ألكيل معوض (C16) ألكيل ، (سي16) ألكينيل معوض (C16ألكينيل ، (سي16) ألكينيل معوض (C16ألكينيل ، (سي520) أريل ، معوض (C520) أريل ، (سي626) الكاريل البديل (C626) alkaryl ، 5-20 عضو heteroaryl ، مستبدل 5-20 عضو heteroaryl ، 6-26 عضو alkheteroaryl أو استبدال 6-26 عضو alkheteroaryl. تشتمل الأحماض الأمينية العطرية المشفرة وراثيًا على Phe و Tyr و Tryp ، بينما تشتمل الأحماض الأمينية العطرية غير المشفرة وراثيًا على فينيل جلايسين ، و 2-napthylalanine ، و beta-2-thienylalanine ، و 1،2،3،4-tetrahydro-isoquinoline-3-carboxylic acid ، 4-كلوروفينيل ألانين ، 2-فلوروب بنيل ألانين 3-فلوروفينيل ألانين ، 4-فلوروفينيل ألانين.

الحمض الأميني الأبولار هو حمض أميني كاره للماء مع سلسلة جانبية غير مشحونة عند درجة الحموضة الفسيولوجية والتي لها روابط يكون فيها زوجان من الإلكترونات المشتركة بين ذرتين متساويين عمومًا في كل من الذرتين (أي الجانب السلسلة ليست قطبية). تشمل الأحماض الأمينية Apolar المشفرة وراثيًا Gly و Leu و Val و Ile و Ala و Met ، بينما تشتمل الأحماض الأمينية Apolar غير المشفرة وراثيًا على سيكلوهكسيل ألانين. يمكن تقسيم الأحماض الأمينية Apolar بشكل أكبر لتشمل الأحماض الأمينية الأليفاتية ، وهو حمض أميني كاره للماء له سلسلة جانبية هيدروكربونية أليفاتية. تشمل الأحماض الأمينية الأليفاتية المشفرة وراثيًا Ala و Leu و Val و Ile ، بينما تشتمل الأحماض الأمينية الأليفاتية غير المشفرة وراثيًا على النورليوسين.

الحمض الأميني القطبي عبارة عن حمض أميني محب للماء له سلسلة جانبية غير مشحونة عند درجة الحموضة الفسيولوجية ، ولكن لها رابطة واحدة يتم فيها تثبيت زوج من الإلكترونات المشتركة بين ذرتين عن كثب بواسطة إحدى الذرات. تشتمل الأحماض الأمينية القطبية المشفرة وراثيًا على Ser و Thr و Asn و Gln ، بينما تشتمل الأحماض الأمينية القطبية غير المشفرة وراثيًا على سيترولين و N-acetyl lysine و methionine sulfoxide.

الأحماض الأمينية الحمضية عبارة عن حمض أميني محب للماء مع قيمة سلسلة جانبية pKa أقل من 7. الأحماض الأمينية الحمضية عادة لها سلاسل جانبية سالبة الشحنة عند درجة الحموضة الفسيولوجية بسبب فقدان أيون الهيدروجين. تشتمل الأحماض الأمينية الحمضية المشفرة وراثيًا على Asp و Glu. الحمض الأميني الأساسي هو حمض أميني محب للماء مع قيمة سلسلة جانبية pKa أكبر من 7. الأحماض الأمينية الأساسية عادة ما يكون لها سلاسل جانبية موجبة الشحنة عند درجة الحموضة الفسيولوجية بسبب ارتباطها بأيون الهيدرونيوم. تشتمل الأحماض الأمينية الأساسية المشفرة وراثيًا على Arg و Lys و His ، بينما تشتمل الأحماض الأمينية الأساسية غير المشفرة وراثيًا على الأحماض الأمينية غير الحلقية ornithine و 2،3 و -diaminopropionic acid و 2،4-diaminobutyric acid و homoarginine.

سوف يدرك شخص ماهر في المجال أن التصنيفات المذكورة أعلاه ليست مطلقة وأنه يمكن تصنيف حمض أميني في أكثر من فئة واحدة. بالإضافة إلى ذلك ، يمكن تصنيف الأحماض الأمينية بناءً على السلوك المعروف و / أو الخصائص الكيميائية أو الفيزيائية أو البيولوجية المميزة بناءً على فحوصات محددة أو مقارنة بالأحماض الأمينية المحددة مسبقًا. يمكن أن تشتمل الأحماض الأمينية أيضًا على شقوق ثنائية الوظيفة لها سلاسل جانبية تشبه الأحماض الأمينية.

يمكن أن تشمل التغييرات المحافظة أيضًا استبدال جزء مشتق كيميائيًا لبقايا غير مشتقة ، على سبيل المثال ، تفاعل مجموعة جانبية وظيفية من حمض أميني. وبالتالي ، يمكن أن تشتمل هذه البدائل على مركبات تم اشتقاق مجموعاتها الأمينية الحرة إلى هيدروكلوريد أمين ، ومجموعات سلفونيل p-toluene ، ومجموعات carbobenzoxy ، ومجموعات t-butyloxycarbonyl ، أو مجموعات chloroacetyl أو مجموعات فورميل. وبالمثل ، يمكن اشتقاق مجموعات الكربوكسيل الحرة لتكوين أملاح ، وإسترات الميثيل والإيثيل أو أنواع أخرى من الإسترات أو الهيدرازيدات ، ويمكن اشتقاق السلاسل الجانبية لتكوين مشتقات O-acyl أو O-alkyl لمجموعات الهيدروكسيل الحرة أو N-im-benzylhistidine لنيتروجين إيميدازول من الهيستيدين. تشتمل نظائر الببتيد أيضًا على الأحماض الأمينية التي تم تغييرها كيميائيًا ، على سبيل المثال ، عن طريق المثيلة ، عن طريق وسط الحمض الأميني الطرفي C بواسطة ألكيل أمين مثل إيثيل أمين ، إيثانول أمين ، أو إيثيلين ديامين ، أو أسيل أو مثيلة لسلسلة جانبية من الأحماض الأمينية (مثل أسيل مجموعة إبسيلون الأمينية من ليسين). يمكن أن تتضمن نظائر الببتيد أيضًا استبدال رابط الأميد في الببتيد بأميد مستبدل (على سبيل المثال ، مجموعات من الصيغة - C (O) --NR ، حيث R هي (C)16) ألكيل ، (سي16ألكينيل ، (سي16) ألكينيل معوض (C16) ألكيل معوض (C16) ألكينيل أو معوض (C16) alkynyl) أو isostere لوصلة أميد (على سبيل المثال ، CH2NH— ، –CH2S ، --CH2CH2- ، - CH═CH - (رابطة الدول المستقلة وعبر) ، —C (O) CH2- ، - CH (OH) CH2- أو - CH2وبالتالي-).

يمكن ربط المركب تساهميًا ، على سبيل المثال ، عن طريق البلمرة أو الاقتران ، لتكوين بوليمرات متجانسة أو بوليمرات غير متجانسة. يمكن استخدام الفواصل والوصلات ، التي تتكون عادةً من جزيئات محايدة صغيرة ، مثل الأحماض الأمينية غير المشحونة في ظل الظروف الفسيولوجية. يمكن تحقيق الروابط بعدة طرق. على سبيل المثال ، يمكن إضافة بقايا السيستين عند طرف الببتيد ، ويمكن ربط العديد من الببتيدات تساهميًا عن طريق الأكسدة الخاضعة للرقابة. بدلاً من ذلك ، يمكن استخدام عوامل غير متجانسة ، مثل عوامل تشكيل ثنائي كبريتيد / أميد أو عوامل تشكيل ثيوثير / أميد. يمكن أيضًا تقييد المركب ، على سبيل المثال ، من خلال وجود أجزاء دورية.

في بعض النماذج ، يمكن استخدام تقنيات النمذجة الجزيئية ثلاثية الأبعاد لتحديد أو توليد مركبات قد تكون مفيدة كعلاجات أو تشخيصات. يمكن استخدام أدوات النمذجة الجزيئية القياسية ، على سبيل المثال ، تلك الموصوفة في L-H Hung و R. Samudrala ، PROTINFO: تنبؤ بنية البروتين الثانوية والثالثية ، Nucleic Acids Research ، 2003 ، المجلد. 31، No. 13 3296-3299 A. Yamaguchi، et al. ، قاعدة FAMSBASE الموسعة: نماذج بنية ثلاثية الأبعاد لتسلسل الجينوم لـ 41 نوعًا ، أبحاث الأحماض النووية ، 2003 ، المجلد. 31، No. 1 463-468 J. Chen، et al.، MMDB: Entrez's 3D-structure database، Nucleic Acids Research، 2003، Vol. 31، No. 1 474-477 R. A. Chiang، et al.، The Structure Superposition Database، Nucleic Acids Research، 2003، Vol. 31 ، رقم 1 505-510.

يمكن تصنيع الببتيدات أو نظائرها من الببتيد بواسطة تقنيات كيميائية قياسية ، على سبيل المثال ، عن طريق التوليف الآلي باستخدام منهجية محلول أو طور صلب. مُصنِّع الببتيد الآلي متاح تجارياً ويستخدم تقنيات معروفة جيداً في المجال. يمكن أيضًا تحضير الببتيدات والنظائر الببتيدية باستخدام تقنية الحمض النووي المؤتلف باستخدام طرق قياسية مثل تلك الموصوفة ، على سبيل المثال ، Sambrook ، et aL (الاستنساخ الجزيئي: دليل المختبر. 2.sup.nd ، ed. ، مختبر كولد سبرينغ هاربور ، مطبعة مختبر كولد سبرينغ هاربور ، كولد سبرينغ هاربور ، نيويورك ، 1989) أو Ausubel et al. (البروتوكولات الحالية في البيولوجيا الجزيئية ، جون وايلي وأولاده ، 1994).

يمكن تحديد المركبات ، مثل الببتيدات (أو نظائرها) عن طريق التجارب الروتينية ، على سبيل المثال ، تعديل البقايا داخل ببتيدات السارس بإدخال بدائل أحماض أمينية مفردة أو متعددة ، أو عمليات حذف ، أو إدخال ، وتحديد تلك المركبات التي تحتفظ بالنشاط البيولوجي ، على سبيل المثال ، تلك المركبات التي لها القدرة على تسمم الخلايا.

بشكل عام ، يتم تحديد المركبات المرشحة للوقاية من الاضطرابات التي يتوسطها فيروس السارس أو علاجها من مكتبات كبيرة من كل من المنتجات الطبيعية أو المستخلصات الاصطناعية (أو شبه الاصطناعية) أو المكتبات الكيميائية وفقًا للطرق المعروفة في المجال. قد تشتمل مركبات المرشح أو الاختبار ، على سبيل المثال لا الحصر ، على الببتيدات ، وعديد الببتيدات ، والجزيئات العضوية المركبة ، والجزيئات العضوية التي تحدث بشكل طبيعي ، وجزيئات الحمض النووي. في بعض النماذج ، تقوم هذه المركبات بفحص القدرة على منع تكاثر فيروس السارس أو الإمراضية ، مع الحفاظ على قدرة الخلية المصابة على النمو أو البقاء على قيد الحياة.

سوف يفهم أولئك المهرة في مجال اكتشاف الدواء وتطويره أن المصدر الدقيق لمستخلصات أو مركبات الاختبار ليست حاسمة بالنسبة لطريقة (طرق) الاختراع. وفقًا لذلك ، يمكن فحص أي عدد تقريبًا من المستخلصات أو المركبات الكيميائية باستخدام الطرق النموذجية الموصوفة هنا أو باستخدام الطرق القياسية. تتضمن أمثلة هذه المستخلصات أو المركبات ، على سبيل المثال لا الحصر ، المستخلصات النباتية أو الفطرية أو بدائية النواة أو المستخلصات الحيوانية ، ومرق التخمير ، والمركبات الاصطناعية ، بالإضافة إلى تعديل المركبات الموجودة. تتوفر أيضًا طرق عديدة لتوليد التخليق العشوائي أو الموجه (على سبيل المثال ، التوليف شبه التوليفي أو التوليف الكلي) لأي عدد من المركبات الكيميائية ، بما في ذلك ، على سبيل المثال لا الحصر ، السكاريد ، والدهون ، والببتيد ، والمركبات القائمة على الحمض النووي . المكتبات المركبة التركيبية متاحة تجارياً. بدلاً من ذلك ، تتوفر مكتبات المركبات الطبيعية في شكل مستخلصات بكتيرية وفطرية ونباتية وحيوانية تجارياً من عدد من المصادر ، بما في ذلك Biotics (Sussex ، المملكة المتحدة) ، Xenova (Slough ، المملكة المتحدة) ، Harbour Branch Oceanographic Institute (Ft. بيرس ، فلوريدا) ، وفارمار ، الولايات المتحدة الأمريكية (كامبريدج ، ماساتشوستس). بالإضافة إلى ذلك ، يتم إنتاج المكتبات الطبيعية والمُنتَجة صناعياً ، على سبيل المثال ، بولي ببتيدات فيروس السارس التي تحتوي على متواليات رائدة ، إذا رغبت في ذلك ، وفقًا للطرق المعروفة في المجال ، على سبيل المثال ، عن طريق الاستخراج القياسي وطرق التجزئة. علاوة على ذلك ، إذا رغبت في ذلك ، يتم تعديل أي مكتبة أو مركب بسهولة باستخدام طرق كيميائية أو فيزيائية أو كيميائية حيوية قياسية.

عندما يتم العثور على مستخلص خام لتعديل السمية الخلوية أو العدوى الفيروسية ، فإن المزيد من تجزئة مستخلص الرصاص الإيجابي ضروري لعزل المكونات الكيميائية المسؤولة عن التأثير الملحوظ. وبالتالي ، فإن الهدف من عملية الاستخراج والتجزئة والتنقية هو التوصيف الدقيق وتحديد الكيان الكيميائي داخل المستخلص الخام الذي له ، على سبيل المثال ، خصائص مضادة للسمية الخلوية أو خصائص مضادة للفيروسات. يمكن استخدام نفس المقايسات الموصوفة هنا لاكتشاف الأنشطة في مخاليط المركبات لتنقية المكون النشط واختبار مشتقاته. طرق تجزئة وتنقية هذه المستخلصات غير المتجانسة معروفة في المجال. إذا رغبت في ذلك ، يتم تعديل المركبات التي تبين أنها عوامل مفيدة للمعالجة كيميائيًا وفقًا للطرق المعروفة في المجال. يمكن تحليل المركبات التي تم تحديدها على أنها ذات قيمة علاجية أو وقائية أو تشخيصية أو أي قيمة أخرى في أنظمة زراعة الخلايا على سبيل المثال ، مثل نظام استزراع Vero E6 ، باستخدام نموذج حيواني النمس ، أو أي نموذج حيواني آخر مناسب لتحليل السارس.

يمكن استخدام مركبات الاختراع لتحضير أجسام مضادة لببتيدات فيروس سارس أو بروتينات أو بروتينات متعددة أو نظائرها ، أو لجزيئات الحمض النووي لفيروس سارس أو نظائرها باستخدام تقنيات التحضير القياسية ، على سبيل المثال ، الموصوفة في Harlow و Lane ( الأجسام المضادة دليل معمل ، مختبر كولد سبرينج هاربور ، كولد سبرينج هاربور ، نيويورك ، 1988) ، أو معروف لأولئك المهرة في المجال. قد تشتمل الأجسام المضادة على أجسام مضادة متعددة النسيلة ، وأجسام مضادة وحيدة النسيلة ، وأجسام مضادة هجينة (على سبيل المثال ، أجسام مضادة ثنائية التكافؤ لها أزواج مختلفة من السلاسل الثقيلة والخفيفة) ، وأجسام مضادة خيمرية (على سبيل المثال ، أجسام مضادة لها مجالات ثابتة ومتغيرة من أنواع و / أو فئة مختلفة) ، وأجسام مضادة معدلة (على سبيل المثال. ، الأجسام المضادة التي تم فيها تغيير التسلسل الذي يحدث بشكل طبيعي من خلال تقنيات إعادة الارتباط على سبيل المثال) ، والأجسام المضادة Fab ، والأجسام المضادة المضادة للنمط الذاتي ، وما إلى ذلك. من نوع واحد وجزء Fc من نوع آخر ، أو باستخدام الأجسام المضادة المصنوعة من الأورام الهجينة من الأنواع المناسبة. على سبيل المثال ، يمكن استخدام الأجسام المضادة "المتوافقة مع البشر" للإعطاء للبشر.

لتوليد أجسام مضادة خاصة بفيروس السارس ، يمكن التعبير عن تسلسل تشفير متعدد الببتيد لفيروس السارس ، على سبيل المثال ، كدمج طرفية C مع الجلوتاثيون S-transferase (GST) (سميث وآخرون ، جين 67: 31-40 ، 1988 ). يمكن بعد ذلك تنقية بولي ببتيد الاندماج على حبيبات الجلوتاثيون - سيفاروز ، مع التصفية التتابعية بالجلوتاثيون المشقوق بالثرومبين (في موقع الانقسام الهندسي) ، وتنقيته إلى الدرجة اللازمة لتحصين الأرانب. يتم إجراء التحصينات الأولية باستخدام مساعد فرويد الكامل والتحصينات اللاحقة بمساعد فرويد غير المكتمل. تتم مراقبة عيار الأجسام المضادة عن طريق تحليلات اللطخة الغربية والترسيب المناعي باستخدام جزء بولي ببتيد فيروس السارس المشقوق بالثرومبين من بولي ببتيد اندماج فيروس GST-SARS. يتم تنقية تقارب الأمصال المناعية باستخدام بولي ببتيد فيروس السارس CNBr-Sepharose المقترن. يتم تحديد خصوصية المصل المضاد باستخدام لوحة من polypeptides GST غير ذات الصلة.

بصفته مناعيًا بديلًا أو مساعدًا لعديد ببتيدات اندماج GST ، يمكن إنشاء الببتيدات المقابلة لبولي ببتيدات فيروس السارس المحبة للماء الفريدة نسبيًا ومقترنة بهيموسيانين ثقب المفتاح (KLH) من خلال ليسين طرفي C مقدم. يتم تنقية المصل المضاد لكل من هذه الببتيدات بالمثل على الببتيدات المقترنة بـ BSA ، ويتم اختبار الخصوصية في ELISA والبقع الغربية باستخدام اقتران الببتيد ، وعن طريق اللطخة الغربية والتراكم المناعي باستخدام بولي ببتيد فيروس السارس معبراً عنه كبولي ببتيد اندماج GST.

بدلاً من ذلك ، يمكن تحضير الأجسام المضادة أحادية النسيلة باستخدام بولي ببتيدات فيروس السارس الموصوف أعلاه وتقنية الورم الهجين القياسي (انظر ، على سبيل المثال ، Kohler et al.، Nature، 256: 495، 1975 Kohler et al.، Eur. J Immunol.6: 511، 1976 Kohler et al.، Eur. J. Immunol.6: 292، 1976 Hammerling et al.، In Monoclonal Antibodies and T Cell Hybridomas، Elsevier، NY، 1981 Ausubel et al.، أعلاه). بمجرد إنتاجها ، يتم أيضًا اختبار الأجسام المضادة أحادية النسيلة للتعرف على عديد ببتيد فيروس السارس المحدد بواسطة لطخة غربية أو تحليل ترسيب مناعي (بالطرق الموضحة في Ausubel et al. ، أعلاه). تعتبر الأجسام المضادة التي تتعرف بشكل خاص على عديد ببتيدات فيروس السارس مفيدة في الاختراع ، ويمكن استخدام مثل هذه الأجسام المضادة ، على سبيل المثال ، في اختبار مناعي لمراقبة مستوى عديد ببتيدات فيروس السارس الذي ينتجه حيوان ثديي (على سبيل المثال ، لتحديد كمية أو موقع عديد ببتيد فيروس السارس).

في نموذج بديل ، لا يتم إنتاج الأجسام المضادة للاختراع فقط باستخدام بولي ببتيد فيروس السارس بأكمله ، ولكن باستخدام شظايا من بولي ببتيد فيروس السارس الفريدة أو التي تقع خارج مناطق محمية للغاية ويبدو من المحتمل أن تكون مولدة للجينات ، وفقًا لمعايير مثل عالية يمكن أيضًا استخدام تواتر المخلفات المشحونة. في أحد الأمثلة المحددة ، يتم إنشاء هذه الأجزاء بواسطة التقنيات القياسية لـ PCR ويتم استنساخها في ناقل تعبير pGEX (Ausubel et al. ، أعلاه). يتم التعبير عن polypeptides الانصهار في بكتريا قولونية وتنقيته باستخدام مصفوفة تقارب الجلوتاثيون agarose كما هو موصوف في Ausubel et al. (أعلاه). في محاولة لتقليل المشاكل المحتملة للانتماء المنخفض أو خصوصية مضاد ، يتم إنشاء اثنين أو ثلاثة من هذه الانصهار لكل عديد ببتيد ، ويتم حقن كل اندماج في اثنين على الأقل من الأرانب. يتم رفع Antisera عن طريق الحقن في سلسلة ، ويفضل أن تشتمل على ثلاث حقن معززة على الأقل. يمكن أيضًا تحضير الأجسام المضادة لفيروس السارس ضد جزيئات الحمض النووي لفيروس السارس.

يمكن استخدام الأجسام المضادة كوسائل تشخيصية أو علاجية أو وقائية للاضطرابات المرتبطة بفيروس السارس. يمكن أيضًا استخدام الأجسام المضادة لعزل فيروس السارس ومركباته عن طريق كروماتوغرافيا التقارب ، على سبيل المثال ، أو لتحديد مركبات فيروس السارس المعزولة أو الناتجة عن تقنيات أخرى.

في بعض الجوانب ، الفحوصات البيولوجية ، مثل التشخيص أو المقايسات الأخرى ، باستخدام حمض نووي عالي الكثافة ، أو عديد الببتيد ، أو صفائف الأجسام المضادة ، على سبيل المثال المصفوفات المصغرة عالية الكثافة أو "المصفوفات الدقيقة" ، لجزيئات الحمض النووي لفيروس سارس أو عديد الببتيدات ، أو الأجسام المضادة القادرة على يمكن إجراء ربط جزيئات الحمض النووي أو عديد الببتيدات على وجه التحديد. يمكن أيضًا استخدام المصفوفات الكبيرة ، التي يتم إجراؤها على سبيل المثال عن طريق تقنيات الإكتشاف اليدوية. تتطلب المصفوفات عمومًا دعمًا صلبًا (على سبيل المثال ، أغشية النايلون ، والزجاج ، والسيراميك ، والبلاستيك ، والسيليكون ، والنيتروسيليلوز أو PVDF ، والخلايا الدقيقة ، والميكروبيدات ، على سبيل المثال ، الميكروبيدات المغناطيسية ، وما إلى ذلك) التي ترتبط بها جزيئات الحمض النووي أو عديد الببتيدات أو الأجسام المضادة. ترتيب ثنائي الأبعاد محدد ، بحيث يمكن تحديد نمط التهجين بسهولة. يمكن أيضًا استخدام صفائف التعليق (الجسيمات المعلقة) التي تم ترميزها لتسهيل التعرف. قد تكون جزيئات الحمض النووي لفيروس السارس أو مجسات أو أهداف متعددة البيبتيد مركبات كما هو موصوف هنا.

في بعض التجسيدات ، يمكن استخدام مصفوفات الحمض النووي عالية الكثافة على سبيل المثال لمراقبة وجود أو مستوى التعبير لعدد كبير من جزيئات أو جينات الحمض النووي لفيروس السارس أو لاكتشاف أو تحديد تسلسل الحمض النووي لفيروس السارس أو الطفرات أو الأشكال المتعددة. لغرض هذه المصفوفات ، قد تشتمل "الأحماض النووية" على أي بوليمر أو قليل القسيمات من النيوكليوزيدات أو النيوكليوتيدات (عديد النيوكليوتيدات أو قليل النوكليوتيدات) ، والتي تشمل قواعد البيريميدين والبيورين ، ويفضل السيتوزين والثيمين واليوراسيل والأدينين والجوانين ، على التوالي ، أو قد تشمل الأحماض النووية الببتيدية (PNA). في سمة بديلة ، يوفر الاختراع مصفوفات دقيقة للحمض النووي بما في ذلك عدد من مصفوفات تسلسل الحمض النووي المميزة للاختراع ، وبالتالي توفير "مجموعات" محددة من المتواليات. قد يكون عدد التسلسلات المميزة على سبيل المثال أي عدد صحيح بين 2 و 1 × 10 5 ، مثل 10 2 أو 10 3 أو 10 4 أو 10 5 على الأقل.

يوفر الاختراع أيضًا مكتبات للتخلص من الجينات والتعبير.وبالتالي ، فإن جزيئات الحمض النووي التي تشفر عديد ببتيدات أو بروتينات فيروسات السارس (على سبيل المثال ، منتجات PCR من ORF أو إجمالي الرنا المرسال) قد يتم ربطها على سبيل المثال بدعامة صلبة ، مهجنة مع cDNAs مفردة ذات علامات يمكن اكتشافها (تقابل اتجاه "مضاد للحساسية") ، وقياس الكمي باستخدام طريقة مناسبة بحيث يتم الكشف عن إشارة في كل موقع حدث فيه التهجين. ستعكس شدة الإشارة بعد ذلك مستوى التعبير الجيني. مقارنة النتائج من الفيروسات ، على سبيل المثال ، من سلالات مختلفة أو من عينات أو مواضيع مختلفة ، من شأنه أن يوضح مستويات مختلفة من التعبير عن الجينات المحددة. باستخدام تقنيات مماثلة ، يمكن التعرف على الأحماض النووية المتماثلة من فيروسات مختلفة إذا تم استخدام الأحماض النووية لفيروس السارس في المصفوفة الدقيقة ، وتم فحصها باستخدام جزيئات الحمض النووي من فيروسات أو مواضيع مختلفة. في بعض التجسيدات ، قد يتضمن هذا النهج إنشاء مكتبات تعبير ORP ذات علامات للجينوم الفيروسي في مضيف بكتيري ، على غرار مكتبة التعبير في الخميرة (Martzen M. وآخرون ، 1999. Science ، 286: 1153). يمكن على سبيل المثال اكتشاف أنشطة البروتين المشفر باستخدام ORF في تجمعات البروتين المنقى الموسومة في الحالات التي لا يمكن فيها اكتشاف الأنشطة في المستخلصات أو الخلايا. في أحد جوانب الاختراع ، يمكن بناء مكتبات مصفوفة من سلالات فيروسية تحمل كل منها بلازميد يعبر عن فيروس SARS مختلف ORF تحت سيطرة محفز محفز. يتم تضخيم ORFs باستخدام PCR واستنساخها في ناقل يمكّن من التعبير عنها على أنها بولي ببتيدات ذات علامات N- طرفية. تُستخدم هذه الأمبليكونات أيضًا في إنشاء مصفوفات دقيقة للتهجين وتمكين تعطيل الجينات المستهدفة ، مما يقلل النفقات. يتم اختيار مضيف تعبير مناسب ، ويتم تحديد الجينات التي تشفر أنشطة كيميائية حيوية معينة عن طريق فحص تجمعات مصفوفة من البروتينات التي تم وضع علامات عليها كما هو موصوف سابقًا (Martzen MR ، و McCraith SM ، و Spinelli SL ، و Torres FM ، و Fields S. ، و Grayhack EJ ، و Phizicky EM ، 1999. العلوم ، 286: 1153).

في بعض النماذج ، يمكن استخدام مصفوفات البروتين (بما في ذلك الجسم المضاد أو صفائف مولد الضد) لتحليل وتحديد عديد ببتيدات فيروس السارس أو استجابات المضيف لمثل هذه البولي ببتيدات. وبالتالي ، يمكن استخدام مصفوفات البروتين لاكتشاف عديد ببتيدات فيروس السارس في مريض يميز عديد ببتيد فيروس سارس من عديد ببتيد مضيف يكتشف التفاعلات بين عديد ببتيدات فيروس السارس وعلى سبيل المثال تحدد البروتينات المضيفة فعالية العلاجات المحتملة ، مثل الجزيئات الصغيرة أو الروابط التي قد تحدد البولي ببتيدات الفيروسية المرتبطة بفيروس السارس تفاعلات البروتين والأجسام المضادة و / أو تكتشف تفاعل تفاعلات الركيزة الإنزيمية. يمكن أيضًا استخدام مصفوفات البروتين لاكتشاف مستضدات فيروس السارس والأجسام المضادة في العينات لتشكيل التشكيل الجانبي لعديد ببتيدات فيروس السارس لتحديد الأجسام المضادة المناسبة أو خريطة الحواتم أو لمجموعة متنوعة من تحليلات وظائف البروتين.

هناك مجموعة متنوعة من الطرق معروفة لصنع واستخدام المصفوفات الدقيقة ، على سبيل المثال تم الكشف عنها في Cheung VG، et al.، 1999. Nature Genetics Supplement، 21: 15-19 Lipshutz RJ، et al.، 1999. Nature Genetics Supplement، 21: 20-24 Bowtell DDL، 1999. Nature Genetics Supplement، 21: 25-32 Singh-Gasson S.، et al.، 1999. Nature Biotechnol.، 17: 974-978 and Schweitzer B.، et al.، 2002. Nature Biotechnol. ، 20: 359-365. وهكذا ، على سبيل المثال ، يمكن تصميم المصفوفات الدقيقة عن طريق تخليق أليغنوكليوتيدات مع تغيرات متوالية بناءً على متواليات مرجعية ، مثل أي متواليات فيروسات SARS موصوفة هنا. تم الكشف عن طرق تخزين بيانات المصفوفات الدقيقة والاستعلام عنها وتحليلها ، على سبيل المثال ، في براءة الاختراع الأمريكية. رقم 6،484،183 براءة الاختراع الأمريكية No. 6،188،783 and Holloway A. J.، et al.، 2002. Nature Genetics Supplement، 32: 481-489. يمكن إنشاء مصفوفات البروتين واكتشافها وتحليلها باستخدام طرق معروفة في المجال على سبيل المثال تقنيات قياس الطيف الكتلي والمقايسات المناعية مثل ELISA والنشاف الغربي (النقطي) جنبًا إلى جنب مع تقنيات الكشف عن التألق على سبيل المثال ، وتكييفها لتحليل الإنتاجية العالية ، كما هو موضح في على سبيل المثال MacBeath، G. and Schreiber، SL Science 2000، 289، 1760-1763 Levit-Binnun N، et al. (2003) الكشف الكمي لمصفوفات البروتين. Anal Chem 75: 1436-41 Kukar T et al. (2002) مصفوفات البروتين الدقيقة للكشف عن تفاعلات البروتين والبروتين باستخدام البروتينات الفلورية الحمراء والخضراء. الشرج Biochem 306: 50-4 Borrebaeck C A ، وآخرون. (2001) رقائق البروتين على أساس شظايا الأجسام المضادة المؤلفة: طريقة حساسة للغاية كما تم الكشف عنها بواسطة مطياف الكتلة. التقنيات الحيوية 30: 1126-1132 Huang R P (2001) الكشف عن البروتينات المتعددة في نظام ميكروأري البروتين القائم على الأجسام المضادة. طرق المناعة J 255: 1-13 Emili A Q و Cagney G (2000) تحليل وظيفي واسع النطاق باستخدام صفائف الببتيد أو البروتين. Nature Biotechnol 18: 393-397 Zhu H، et al. (2000) تحليل كينازات بروتين الخميرة باستخدام رقائق البروتين. Nature Genet 26: 283-9 Lueking A، et al. (1999) مصفوفات البروتين الدقيقة للتعبير الجيني وفحص الأجسام المضادة. شرجي. بيوتشيم. 270: 103-111 أو Templin M F ، وآخرون. (2002) تقنية ميكروأري البروتين. اكتشاف المخدرات اليوم 7: 815-822. تتوفر أدوات تقنيات ميكروأري تجاريًا على سبيل المثال من Affymetrix، Santa Clara، Calif. Nanogen، San Diego، California. أو Sequenom، San Diego، California.

سجلات الكمبيوتر المقروءة

يمكن توفير متواليات الحمض النووي والبولي ببتيد ، كما هو موصوف في هذه الوثيقة ، أو جزء منها ، في مجموعة متنوعة من الوسائط لتسهيل الوصول إلى هذه التسلسلات وتمكين استخدامها. وفقًا لذلك ، يمكن تسجيل تسلسل الحمض النووي وفيروس السارس متعدد الببتيد الخاص بالاختراع أو تخزينه على وسائط يمكن قراءتها بواسطة الكمبيوتر ، باستخدام أي تقنية وصيغة مناسبة للوسيط المعين.

في نماذج بديلة ، يوفر الاختراع وسائط قابلة للقراءة بالكمبيوتر مشفرة بعدد من متواليات بيانات الحمض النووي أو الأحماض الأمينية المميزة للاختراع. قد يكون عدد التسلسلات المميزة على سبيل المثال أي عدد صحيح بين 2 و 1 × 10 5 ، مثل 10 2 أو 10 3 أو 10 4 أو 10 5 على الأقل. في أحد النماذج ، يحتوي الاختراع على وسيط كمبيوتر به عدد كبير من سجلات البيانات المشفرة رقميًا. يمكن أن يشتمل كل سجل بيانات على قيمة تمثل سلسلة حمض نووي أو حمض أميني للاختراع. في بعض النماذج ، قد يشتمل سجل البيانات أيضًا على قيم تمثل مستوى التعبير أو المستوى أو نشاط حمض نووي أو تسلسل حمض أميني للاختراع. يمكن تنظيم سجل البيانات كجدول ، على سبيل المثال ، جدول يمثل جزءًا من قاعدة بيانات مثل قاعدة بيانات علائقية (على سبيل المثال ، قاعدة بيانات SQL لبيئات قاعدة بيانات Oracle أو Sybase). يتضمن الاختراع أيضًا طريقة لتوصيل المعلومات حول عينة ، على سبيل المثال عن طريق إرسال المعلومات ، على سبيل المثال إرسال سجل كمبيوتر يمكن قراءته كما هو موصوف هنا ، على سبيل المثال عبر شبكة كمبيوتر. يمكن الوصول بشكل روتيني إلى متواليات البولي ببتيد والحمض النووي الخاصة بالاختراع ومعلومات التسلسل المتعلقة بهما بواسطة أحد أصحاب المهارة العادية في المجال لمجموعة متنوعة من الأغراض ، بما في ذلك لأغراض المقارنة بين متواليات متطابقة إلى حد كبير ، وما إلى ذلك. تم تسهيله باستخدام البرامج المتاحة للجمهور كما هو موضح هنا. يقصد بعبارة "الوسائط القابلة للقراءة على الكمبيوتر" أي وسيط يمكن قراءته والوصول إليه مباشرة بواسطة الكمبيوتر. تشمل هذه الوسائط ، على سبيل المثال لا الحصر: وسائط التخزين المغناطيسية ، مثل الأقراص المرنة ، ووسيط تخزين القرص الصلب ، ووسائط التخزين الضوئية لشريط مغناطيسي مثل وسائط التخزين الكهربائية مثل ذاكرة الوصول العشوائي (RAM) وذاكرة القراءة فقط (ROM) والهجين من هذه الفئات مثل وسائط التخزين المغناطيسية / البصرية.

التركيبات الصيدلانية والبيطرية والجرعات والإدارة

يمكن توفير مركبات الاختراع بمفردها أو مع مركبات أخرى (على سبيل المثال ، جزيئات صغيرة أو ببتيدات أو نظائر ببتيد) ، في وجود جسيم شحمي ، مادة مساعدة ، أو أي مادة حاملة مقبولة صيدلانيًا ، في صورة مناسبة للإعطاء للإنسان أو للحيوانات.

يمكن استخدام الممارسة الصيدلانية التقليدية لتوفير تركيبات أو تركيبات مناسبة لإدارة المركبات للمرضى الذين يعانون من السارس أو الذين يعانون من أعراض سابقة له. يمكن استخدام أي طريقة مناسبة للإعطاء ، على سبيل المثال ، عن طريق الحقن ، أو في الوريد ، أو تحت الجلد ، أو في العضل ، أو داخل الجمجمة ، أو داخل الحجاج ، أو في العين ، أو داخل البطين ، أو داخل المحفظة ، أو داخل النخاع ، أو داخل الصفاق ، أو داخل الصفاق ، أو داخل الأنف ، أو الهباء الجوي ، أو عن طريق الفم. في بعض النماذج ، يتم توصيل المركبات مباشرة إلى الرئة ، على سبيل المثال ، تركيبات مناسبة للاستنشاق. في بعض التجسيدات ، يمكن استخدام تقنيات المعالجة الجينية لإعطاء جزيئات الحمض النووي لفيروس سارس ، على سبيل المثال ، كلقاحات DNA ، ويمكن أن تكون التركيبات في شكل محاليل سائلة أو معلقات للإعطاء عن طريق الفم ، وقد تكون التركيبات على شكل أقراص أو كبسولات وللتركيبات داخل الأنف ، على شكل مساحيق أو قطرات أنف أو رذاذ.

تم العثور على طرق معروفة في فن صنع الصيغ في ، على سبيل المثال ، "Remington's Pharmaceutical Sciences" (الطبعة 18) ، ed. A. Gennaro، 1990، Mack Publishing Company، Easton، Pa. قد تحتوي تركيبات الإعطاء بالحقن ، على سبيل المثال ، على سواغات أو ماء معقم أو محلول ملحي أو بولي ألكلين جليكول مثل البولي إيثيلين جلايكول أو زيوت من أصل نباتي أو نفثالينات مهدرجة. يمكن استخدام بوليمر لاكتيد متوافق حيويًا وقابل للتحلل الحيوي أو بوليمر مشترك لاكتيد / جليكوليد أو بوليمرات مشتركة بولي أوكسي إيثيلين وبولي أوكسي بروبيلين للتحكم في إطلاق المركبات. تشمل أنظمة توصيل الحقن الأخرى المفيدة المحتملة للمركبات المعدلة جزيئات البوليمر المشترك من إيثيلين - فينيل أسيتات ، والمضخات التناضحية ، وأنظمة التسريب القابلة للزرع ، والجسيمات الشحمية. قد تحتوي تركيبات الاستنشاق على سواغ ، على سبيل المثال ، اللاكتوز ، أو قد تكون محاليل مائية تحتوي ، على سبيل المثال ، بولي أوكسي إيثيلين 9-لوريل إيثر ، غليكوكولات وديوكسيكولات ، أو قد تكون محاليل زيتية للإعطاء على شكل قطرات أنف ، أو هلام.

إذا رغبت في ذلك ، يمكن دمج العلاج بمركب وفقًا للاختراع مع علاجات أكثر تقليدية للمرض.

بالنسبة للتركيبات العلاجية أو الوقائية ، يتم إعطاء المركبات للفرد بكمية كافية لإيقاف أو إبطاء تكاثر فيروس السارس ، أو لمنح مناعة وقائية ضد عدوى فيروس السارس في المستقبل. تختلف المبالغ التي تعتبر كافية وفقًا للمركب المحدد المستخدم ، وطريقة الإعطاء ، ومرحلة المرض وشدته ، والعمر ، والجنس ، وصحة الفرد المعالج ، والعلاجات المتزامنة. ومع ذلك ، كقاعدة عامة ، يمكن أن تتراوح الجرعات من حوالي 1 ميكروغرام إلى حوالي 100 مجم لكل كيلوغرام من وزن الجسم لجرعة أولية ، مع تعديلات لاحقة اعتمادًا على استجابة المريض ، والتي يمكن قياسها ، على سبيل المثال عن طريق تحديد الوجود من جزيئات الحمض النووي السارس ، أو polypeptides ، أو virions في الدم المحيطي للمريض.

في حالة تركيبات اللقاح ، يمكن توفير كمية مؤثرة غير مناعية لمركب الاختراع ، بمفردها أو مع مركبات أخرى ، مع مادة مساعدة ، على سبيل المثال ، مادة مساعدة غير مكتملة من Freund أو هيدروكسيد الألومنيوم. يمكن أيضًا ربط المركب بجزيء ناقل ، مثل ألبومين مصل الأبقار أو الهيموسيانين ذي الثقب المفتاحي لتعزيز المناعة. بشكل عام ، يجب استخدام مركبات الاختراع دون التسبب في سمية كبيرة. يمكن تحديد سمية مركبات الاختراع باستخدام تقنيات قياسية ، على سبيل المثال ، عن طريق الاختبار في مزارع الخلايا أو حيوانات التجارب وتحديد المؤشر العلاجي ، أي النسبة بين LD50 (الجرعة المميتة إلى 50٪ من السكان) و LD100 (الجرعة المميتة لـ 100٪ من السكان). ومع ذلك ، في بعض الظروف ، كما هو الحال في حالات المرض الشديدة ، قد يكون من الضروري إدارة تجاوزات كبيرة في التركيبات.

تم إجراء عزل الفيروس على عينة غسيل القصبات الهوائية لحالة سارس قاتلة تنتمي إلى مجموعة الحالة الأصلية من تورنتو ، كندا. تم إجراء جميع الأعمال مع العامل المعدي في مختبر مستوى السلامة الحيوية 3 (BSL3) باستخدام قناع N100 للحماية الشخصية. تمت إزالة العينات من BSL3 بعد إضافة المخزن المؤقت لاستخراج الحمض النووي الريبي. تمت زراعة عزل الفيروس المسمى "عزلة Tor2" في خلايا كلية كلى القرد الأخضر الأفريقي (Vero E6) ، وتمت تنقية الجزيئات الفيروسية ، وتم استخلاص المادة الوراثية (RNA) من عزلة Tor2 (Poutanen، SM et al.، إنجل جي ميد ، 10 أبريل 2003). وبشكل أكثر تحديدًا ، تم استخدام مائة عينة ميكرولتر لتلقيح خلايا Vero E6 (ATCC CRL 1586) على Dulbecco's Modified Eagle Medium المكمّل بالبنسلين / الستربتومايسين ، الجلوتامين و 2٪ مصل العجل الجنيني. حضنت الثقافة عند 37 درجة مئوية لوحظ تأثير ممرض للخلايا بعد 5 أيام من التلقيح. تم نقل الفيروس إلى خلايا Vero E6 المصنفة حديثًا والتي أظهرت تأثيرًا ممرضًا للخلايا في وقت مبكر من يومين بعد الإصابة (تعدد العدوى 10 −2). تم تحضير مخزون الفيروس من الممر 2 من هذه الخلايا وحفظه في النيتروجين السائل. تم تحديد عيار مخزون الفيروس ليكون 1 × 10 7 وحدات تشكيل البلاك (pf.u.) بمقايسة البلاك و 5 × 10 6 عن طريق جرعة معدية من زراعة الأنسجة (TCID).

بالنسبة لانتشار الفيروس ، تم إصابة 10 × قوارير T-162 من خلايا Vero E6 بعدوى متعددة تبلغ 10 −2. عندما أظهرت الخلايا المصابة تأثيرًا خلويًا لـ "4+" (48 ساعة بعد الإصابة) ، تم بعد ذلك تجميد الثقافات وإذابتها لتحليل الخلايا ، وتم توضيح المواد الطافية من حطام الخلية عن طريق الطرد المركزي عند 10000 دورة في الدقيقة في بيكمان عالي السرعة جهاز الطرد المركزي. تمت معالجة المواد الطافية باستخدام DNAse و RNAse لمدة 3 ساعات عند 37 درجة مئوية لإزالة أي أحماض نووية جينية خلوية واستخلاصها لاحقًا بحجم متساوٍ من 1،1،2-trichloro-trifluoroethane. تم الطرد المركزي الفائق للجزء العلوي من خلال تدرج خطوة جلسرين بنسبة 5٪ / 40٪ عند 151000 × جم لمدة ساعة واحدة عند 4 درجات مئوية. تم إعادة تعليق حبيبات الفيروس في برنامج تلفزيوني. تم عزل RNA باستخدام مجموعة تجارية من QIAGEN وتم تخزينه عند -80 درجة مئوية للاستخدام الإضافي.

بناء مكتبة (كدنا)

تم التعامل مع الحمض النووي الريبي والمنتجات اللاحقة في ظل ظروف السلامة الحيوية من المستوى 2 (BSL2). تم تحويل عينة الحمض النووي الريبي إلى مكتبة (كدنا) ، باستخدام إستراتيجية فتيلة عشوائية مجمعة و oligo-dT ، وتمت معالجة المستنسخات دون الجينية الناتجة تحت ظروف السلامة الحيوية من المستوى 1. وبشكل أكثر تحديدًا ، تم استخدام الحمض النووي الريبي الفيروسي المنقى (55 نانوغرام) في بناء مكتبة (كدنا) معدة عشوائيًا ومُستَهَبة أوليجو- dT ، باستخدام نظام اختيار SuperScript لتخليق cDNA (Invitrogen). الوصلات 5′-AATTCGCGGCCGCGTCGAC-3 ، رقم معرف التسلسل: 195 ، و 5′-pGTCGACGCGGCCGCG-3 ، معرف التسلسل رقم: 196 ، تم ربطها بعد توليف (كدنا). تم تصور منتجات تخليق (كدنا) على المواد الهلامية الاغاروز ، وكشف عن اللطاخة منخفضة العائد المتوقعة. لإنتاج cDNA كافية للاستنساخ ، تم تجزئة حجم منتج (كدنا) على هلام agarose تحضيري منخفض نقطة الانصهار ، متبوعًا بتضخيم PCR باستخدام جهاز PCR التمهيدي 5′AATTCGCGGCCGCGTCGAC-3 ، رقم تعريف التسلسل: 197 ، خاص بالروابط. وقد أسفر ذلك عن مادة كافية للاستنساخ.

تم استنساخ منتجات (كدنا) التي تم تحديد حجمها وتم إنشاء قراءات تسلسلية مفردة من كل نهاية للإدراج من الحيوانات المستنسخة المختارة عشوائيًا. يتم توفير قائمة باستنساخ فيروس السارس في قائمة التسلسل المصاحبة ، والتي تم دمجها بالرجوع إليها هنا (أرقام معرف التسلسل: 92-159 و 208 و 209).

بشكل أكثر تحديدًا ، تم ربط cDNAs المختارة بالحجم في ناقل استنساخ pCR4-TOPO TA (Invitrogen ، CA) ، أو بعد الهضم باستخدام نوكلياز التقييد ليس I في ناقل pBR194c (معهد أبحاث الجينوم ، روكفيل ، ماريلاند ، الولايات المتحدة الأمريكية) . تم بعد ذلك تحويل الحيوانات المستنسخة المربوطة عن طريق التثقيب الكهربائي إلى خلايا DH10B T1 (Invitrogen) ، مطلية على ألواح أجار 22 سم بالمضاد الحيوي المناسب وتنمو لمدة 16 ساعة عند 37 درجة مئوية. ونمت في حاضنة اهتزاز لمدة 18 ساعة عند 37 درجة مئوية تم تفكيك الخلايا وتنقية الحمض النووي باستخدام إجراءات معملية قياسية. كانت الاشعال التسلسلية للنسخات 194c 5′-GGCCTCTTCGCTATTACGC-3 (التمهيدي الأمامي) (رقم معرف التسلسل: 159) و 5 TGCAGGTCGACTCTAGAGGAT-3 (التمهيدي العكسي) (رقم معرف التسلسل: 198).

تسلسل الحمض النووي وتجميع القراءات

تم تجميع التسلسلات وتحرير التجميع لإنتاج التسلسل الجيني لفيروس السارس. وبشكل أكثر تحديدًا ، تم تحقيق تسلسل الحمض النووي لكلا طرفي قوالب البلازميد باستخدام كاشف فاصل BigDye Applied Biosystems (الإصدار 3) ، مع الرحلان الكهربائي وجمع البيانات على أدوات AB 3700 و 3730 XL تم فحص قراءات تسلسل الحمض النووي بحثًا عن تسلسلات ملوثة غير فيروسية ، وتم قصها. للجودة باستخدام PHRED (Ewing و B و P. Green ، الدقة الجينوم 8، 186-94، March، 1998) وتم تجميعها باستخدام PHRAP (Gordon، D. et al. الدقة الجينوم 8 ، 195-202 ، مارس ، 1998). في الوقت نفسه ، تم استخدام التسلسلات في عمليات البحث بلاست عن النيوكليوتيدات الفيروسية ومجموعات بيانات البروتين غير الزائدة عن الحاجة (NCBI ، المكتبة الوطنية للطب) للبحث عن أوجه التشابه. تم تصور مجموعات التسلسل باستخدام CONSED (Gordon ، D. et al. الدقة الجينوم 8 ، 195-202 ، مارس ، 1998). تم تحديد التجميعات الخاطئة في التسلسل ووصلات contig باستخدام Miropeats (Parsons ، J.D ، تطبيق Comput Biosci 11 ، 615-9 (ديسمبر 1995). مع تراكم بيانات التسلسل ، تم تجميع التسلسلات الإضافية حتى أصبح من الواضح أن العمق الإضافي لأخذ العينات كان يزيد من عمق التغطية ولكن لا يطيل طول كونتيج. في هذه المرحلة ، تم إنشاء 3،080 قراءة تسلسلية ، تم تجميع 2634 منها في كونتيج واحد كبير.

تم استيراد معلومات التسلسل إلى قاعدة بيانات ACEDB (Durbin، J. Thierry-Mieg. 1991. A C. elegans Database. الوثائق والرموز والبيانات المتاحة من خوادم FTP المجهولة في lirmm “dot” lirmm “dot” fr cele “dot” mrc-1mb "dot" cam "dot" ac "dot" uk و ncbi "dot" n1m "dot" nih "dot" gov) وتخضع لتحليل بيولوجي بما في ذلك تحديد إطارات القراءة المفتوحة ، واكتشاف التسلسلات المماثلة بواسطة BLAST و البحث عن تغيرات الإطارات الظاهرة. عندما تم تحديد الإطارات من خلال هذا التحليل ، تمت استشارة مجموعة التسلسل للحصول على دليل على أخطاء التسلسل وإذا تم العثور عليها ، تم تصحيحها. تم البحث في التسلسلات أيضًا عن أي تسلسل يمكن أن يمد نهاية 5 للتسلسل وتم دمجها عند العثور عليها. تم تحديد وحل التناقضات عالية الجودة في التسلسل بين قراءات التسلسل المختلفة. تم تحديد قراءات التسلسل المصنفة على أنها محذوفة أو خيالية من خلال الفحص اليدوي وإزالتها من التجميع. التسلسل الناتج لديه متوسط ​​درجة جودة إجماع PHRED يبلغ 89.96. توجد قواعد الجودة الأقل في التجميع في المنطقة المجاورة مباشرة للنهايات 5 و 3 من الجينوم الفيروسي ، مع أقل قاعدة جودة لها درجة PHRED تبلغ 35. معظم (29،694 من 29،736 (99.86٪)) من القواعد لديها درجة إجماع تبلغ 90.يتم تمثيل جميع مناطق الجينوم تقريبًا بقراءات مستمدة من كلا خيوط قوالب تسلسل البلازميد ، والاستثناءات هي 50 قاعدة في نهاية 5 ممثلة بقراءة تسلسل واحد ، و 5 قواعد في الطرف 3 ممثلة بقراءة واحدة . يتم تمثيل متوسط ​​القاعدة في التجميع بـ 30 قراءة في الاتجاه الأمامي و 30 قراءة في الاتجاه العكسي ، كما هو محدد بواسطة PHRED. تنبأت منتجات RT-PCR من التسلسل وامتداد الجينوم بأكمله لمنتجات PCR بالحجم المتوقع على المواد الهلامية agarose. لتأكيد النهاية 5 ′ لسباق الجينوم الفيروسي ، تم إجراء باستخدام مجموعة RLM-RACE من Ambion ، والبادئات 5′-CAGGAAACAGCTATGACACCAAGAACAAGGCTCTCCA-3 ′ (رقم معرّف التسلسل: 90) و 5′-CAGGAAACAGCTATGACGATAGGGACCTCTCC : 91). تم استعادة أربعة عشر استنساخًا وتسلسلها. أكد تحليل هذه التسلسلات النهاية الخامسة لجينوم الفيروس التاجي. تم إيداع التسلسلات الجينومية لـ SARS في Genbank (الانضمام. AY274119.1 و AY274119.2 و AY274119.3).

بينما تم وصف الاختراع فيما يتعلق بتجسيدات محددة له ، سيكون من المفهوم أنه قادر على إجراء المزيد من التعديلات وأن هذا التطبيق يهدف إلى تغطية أي اختلافات أو استخدامات أو تعديلات على الاختراع بعد ، بشكل عام ، مبادئ بما في ذلك حالات الخروج عن الكشف الحالي التي تندرج ضمن الممارسة المعروفة أو العرفية في المجال الذي يتعلق به الاختراع ، ويمكن تطبيقها على السمات الأساسية المنصوص عليها هنا وفي نطاق عناصر الحماية الملحقة.

جميع براءات الاختراع وطلبات براءات الاختراع والمنشورات المشار إليها في هذا المستند مدمجة بموجب هذه الوثيقة بالإحالة بكاملها إلى الحد نفسه كما لو أن كل براءة اختراع فردية أو طلب براءة اختراع أو منشور قد تم تحديده على وجه التحديد وبشكل فردي ليتم دمجه بالإحالة في مجملها.


تبلور الجسيمات النانوية المعدنية على أليغنوكليوتيدات قصيرة الحمض النووي في محلول مائي قلوي

تم تبلور جزيئات الفضة والزنك والنحاس بشكل اختزالي على ديكانوكليوتيدات الحمض النووي أحادية السلسلة المحتوية على الثايمين ، في محاليل مائية تحتوي على أيونات المعادن المقابلة وبوروهيدريد الصوديوم ، عند 4 درجات مئوية ، ودرجة الحموضة 11.8 ، و 15 ملي مولار من كلوريد الصوديوم. لم تتشكل جزيئات الحديد النانوية في ظل هذه الظروف. تمت مراقبة تكوين الركام بواسطة القياس الطيفي للأشعة المرئية وفوق البنفسجية ، وتميزت بالمسح المجهري الإلكتروني وتشتت الضوء الديناميكي. أظهرت أطياف الامتصاص لمعظم العينات المحتوية على Ag + نطاقًا رئيسيًا يتركز حول 425 نانومتر وكتف بين 500 و 600 نانومتر ، مما يدل على وجود جزيئات الفضة في توزيع واسع الحجم ، في نطاق 0.1-5 ميكرومتر. تم التحقق من ذلك عن طريق الصور المجهرية وتوزيع الحجم الذي لوحظ في ملفات تعريف التشتت. يشير مورفولوجيا الجسيمات الفضية إلى تكوين هياكل مكعبة بدلاً من الأشكال الهندسية الكروية. في حالة جسيمات الزنك والنحاس النانوية ، تبلورت الهياكل شبه الكروية التي يبلغ طولها حوالي 100 نانومتر على طول سلاسل الحمض النووي عن طريق تفاعل الاختزال ، ثم تم إطلاقها إلى المذيب السائب. تُظهر بقايا الثايمين فعالية أعلى في تنوي الكاتيونات المعدنية مقارنة بالقواعد النووية الأخرى للحمض النووي ، لا سيما في شكلها المنفصل ، عند قيم الأس الهيدروجيني العالية. تؤثر الأدينينات المرافقة للتشغيل المركزي للقواعد القابلة للإزالة في سلسلة نموذج قليل النوكليتايد على إنتاج بلورات الفضة على أجهزة فك تشفير الحمض النووي. قيمة الأس الهيدروجيني وتركيز كلوريد الصوديوم لهما تأثير كبير على إنتاج جزيئات الفضة ، حيث إن الظروف القلوية والقوة الأيونية المعتدلة مطلوبة لبلورة هذه الهياكل. قد يكون لضبط حجم وتشكل الجسيمات النانوية المعدنية عن طريق الاختيار الصحيح لتسلسل قليل النوكليوتيد والظروف الفيزيائية تطبيقات مثيرة للاهتمام في مجال التكنولوجيا الحيوية النانوية.

هذه معاينة لمحتوى الاشتراك ، والوصول عبر مؤسستك.


مناقشة

تم اقتراح أن CST عبارة عن مجمع يشبه RPA خاص بالتيلوميرات 12. أظهرت الدراسات الهيكلية الحديثة التي أجريناها ومجموعات أخرى تشابهًا بنيويًا وثيقًا بين Stn1-Ten1 و RPA32-RPA14 22 ، 23. على الرغم من توفر بنية الحل الخاصة بطية OB المرتبطة بالحمض النووي لـ Cdc13 ، فإن العلاقة بين Cdc13 و RPA70 تظل غير واضحة بسبب نقص المعلومات الهيكلية عن مناطق أخرى من Cdc13 وعدم وجود تشابه تسلسلي بين Cdc13 و RPA. في هذا العمل ، توفر تحليلاتنا المعلوماتية الحيوية والهيكلية أول دليل مباشر على وجود طيات OB متعددة في Cdc13 ، والتي تتميز بـ RPA70. التشابه بين Cdc13OB1-الرئيسية 1CBM وتمدد مجمعات RPA70N-p53 بشكل إضافي التوازي بين Cdc13 و RPA70 (الشكل 4C و 4 D). ومع ذلك ، على الرغم من أوجه التشابه هذه ، هناك اختلافات جوهرية بين Cdc13 و RPA70. أولاً ، على عكس Stn1-Ten1 ، لا يظهر أي من طيات OB المحددة هيكليًا لـ Cdc13 تشابهًا مع نظيراتها في RPA70 خارج نوى البرميل المركزية (الشكل 2 ب) 25 ، 26. ثانيًا ، يلزم طيات OB المركزية لـ RPA70 لربط الحمض النووي الفعال ، بينما يستخدم Cdc13 فقط OB3 للربط 41. تشير هذه الاختلافات الواضحة إلى أن التشابه بين Cdc13 و RPA70 قد يكون نتيجة للتطور المتقارب. بعبارة أخرى ، قد لا يكون Cdc13 قد تطور من RPA70 الأجداد ، ولكن بدلاً من ذلك تم تجنيده بواسطة مجمع Stn1-Ten1 لتوفير نشاط ربط الحمض النووي أحادي السلسلة. تمشيا مع هذه الفكرة ، وجدنا ذلك الكانديدا النيابة. تحتوي بروتينات Cdc13 على طيتين OB فقط تتوافقان مع النصف C الطرفي من السكريات النيابة. البروتينات. بالإضافة إلى ذلك ، فإن بروتينات CTC1 التي تم تحديدها مؤخرًا ، وهي أكبر المكونات في مجمعات CST البشرية والنباتية ، هي بروتينات أكبر بكثير ولا تظهر أي تشابه تسلسلي مع Cdc13 أو RPA70 ، مما يدعم الأصول المتباينة لهذه البروتينات 17 ، 18. بينما لا يمكننا استبعاد احتمال أن يكون الأصل المشترك لهذه البروتينات محجوبًا بسبب الاختلاف التطوري السريع للغاية ، يبدو من الواضح أن العلاقات الهيكلية والوظيفية بين Cdc13 / CTC1 و Stn1-Ten1 مختلفة تمامًا عن تلك الموجودة بين RPA70 و RPA32–14 .

إحدى النتائج اللافتة للنظر لهذه الدراسة هي أن homodimerization يبدو أنه سمة محفوظة لـ Cdc13. ماعدا CgCdc13 ، معظم السكريات و Kluyveromyces تشكل بروتينات Cdc13 ثنائيات من خلال مجالات N-terminal OB1. في المقابل ، فإن homodimerization من الكانديدا بروتينات Cdc13 و Cgيتم توسط Cdc13 بواسطة طية OB C- الطرفية. استخدام OB4 ل dimerization بواسطة CgCdc13 مفاجئ إلى حد ما ، بالنظر إلى القرابة الأقرب لهذه الخميرة السكريات من ل الكانديدا النيابة. ربما يمثل هذا حالة أخرى من التطور المتقارب. على سبيل المثال ، الخسارة العرضية لـ OB1 dimerization بواسطة Cgقد يكون Cdc13 قد وفر ضغط الاختيار لتطور آليات dimerization أخرى ، مما أدى في النهاية إلى استخدام OB4. يشير انتشار dimerization Cdc13 إلى أن هذه الخاصية قد تسهل تفاعل Cdc13 مع أهداف متعددة. على سبيل المثال ، إحدى الوظائف الثابتة لـ OB1 dimerization هي تسهيل التفاعل مع Pol1 أظهرت بيانات الطفرات الخاصة بنا بوضوح أن dimerization الشوريمطلوب مجال Cdc13 OB1 للربط Pol1. أهمية ثنائي أكسيد OB4 أقل وضوحًا. تم اقتراح وظيفة محتملة لتقليص هذا المجال من خلال تجانس العديد من البروتينات المرتبطة بالتيلومير مثل خميرة الانشطار Taz1 و TRF1 البشري و TRF2 42 ، 43 ، 44 ، 45 ، 46. بسبب التقارب الجوهري المنخفض لمجالات ربط الحمض النووي الفردية ، تتطلب هذه البروتينات ثنائية الأبعاد لتفاعل الحمض النووي التيلومير المستقر 42 ، 44 ، 46. وهكذا ، على الرغم من أن S. cerevisiae يمكن أن يربط Cdc13 الحمض النووي بشكل واضح باعتباره مونومر ، فمن الممكن أن يكون تقزيم بروتينات Cdc13 الأصغر في الكانديدا النيابة. قد يعزز نشاطهم المرتبط بالحمض النووي. في الواقع ، وجدنا مؤخرًا أن OBDBD من ط ميتفاعل Cdc13 بشكل ضعيف مع تكرار التيلومير المشابه ويتطلب مجال OB4 لربط الحمض النووي عالي التقارب (EYY و NL ، مخطوطة قيد الإعداد). تم اقتراح وظيفة أخرى محتملة لـ Cdc13 dimerization من خلال multimerization المبلغ عنها لمركب التيلوميراز. على الرغم من أن البيانات غير حاسمة إلى حد ما ، فقد تم اقتراح كل من الخميرة والتيلوميراز البشري للعمل كمخفتات 47 ، 48. نظرًا لأنه من المعروف أن Cdc13 يتفاعل مع مكون Est1 من تيلوميراز الخميرة ، يمكن أن يساعد تضاعف Cdc13 في وضع مجمعين تيلوميراز في مكان قريب من أجل الوظيفة المناسبة. هناك حاجة إلى مزيد من الدراسات لاختبار هذه الاحتمالات والكشف عن الأهمية الوظيفية الكاملة لثنائي Cdc13 في تنظيم تيلوميرات الخميرة الناشئة والحفاظ عليها.


النتائج

التحقق من صحة WBS-PCR باستخدام mRNAs المعبر عنها داخليًا

يستخدم إجراء WBS-PCR (الشكل التكميلي S1) مقاطع عرضية سهمية 40 ميكرومتر من الماوس ، يتم إنشاؤها عادةً لدراسات التوزيع الحيوي للمركبات العلاجية الجديدة ذات العلامات الإشعاعية التي تتضمن التصوير الإشعاعي الذاتي الكمي لكامل الجسم (QWBA) ، الدقة المكانية من صفيحة دائرية 1536 ومخزن فعال لتحلل الأنسجة. من خلال وضع قسم الماوس على لوحة 1536-well المملوءة مسبقًا واستخراج الهدف من الأنسجة المكشوفة ببساطة عن طريق قلب اللوحة ، يتم فك المقطع بالكامل في محلولات أنسجة منفصلة ، والتي يمكن إخضاعها لفحوصات تحليلية متدرجة مثل RT-QPCR. عادةً ما يغطي قسم الماوس 363 بئراً من الصفيحة ذات 1536 بئراً والتي ، عند تحليلها على لوحة qPCR ذات 384 بئراً ، تحتفظ بـ 20 بئراً لإدراج عينات أو معايير مرجعية. بعد ذلك ، باستخدام جداول البيانات (مثل Excel) وبرامج التصوير (مثل عرض الأنسجة) ، يتم تصور توطين التحليل عن طريق تحويل إشارات qPCR إلى صورة وتراكبها مع صورة مأخوذة من المقطع العرضي لكامل الجسم قبل إجراء الاستخراج.

نظرًا لأن مختلف RNAs و oligonucleotides (مثل mRNA و miRNA و siRNA و antagomir) تتطلب طرق تنقية مختلفة لعزلها الأمثل عن الأنسجة ، فقد بحثنا في إمكانية قياس مستوياتها مباشرة في محللات الأنسجة دون الحاجة إلى خطوات تنقية واسعة النطاق. يقلل هذا النهج من فقدان شدة الإشارة بسبب إجراءات التنقية المتحيزة ويسمح بتحليل العينة باستخدام روبوتات مناولة السوائل. ميزة أخرى لهذا النهج هي أن lysates تحتوي على الحمض النووي الجيني الداخلي ، والذي يمكن استخدامه لتطبيع إشارات mRNA التي تم الحصول عليها في RT-qPCR (15 ، 16) دون الحاجة إلى تحليل لوحات كبيرة من جينات التدبير المنزلي (17). من ناحية أخرى ، هناك عيب محتمل لهذا النهج هو أن معظم الكواشف المستخدمة في تحضير محلولات الأنسجة تحتوي على مبطلات بروتينية قوية ، وتركيزات عالية من الملح وعوامل مخلبية ، والتي يمكن أن تثبط أو تقلل من كفاءة التفاعلات الأنزيمية المطلوبة للتقدير الكمي (18) . ومع ذلك ، من خلال الاستفادة من حساسية المقايسات القائمة على RT-qPCR النموذجية ، يمكن السماح باستخدام هذه الكواشف من خلال دمج خطوة تخفيف لتقليل أو إزالة العناصر المثبطة التي تم إدخالها أثناء إجراء الاستخراج. لقد اختبرنا العديد من مخازن التحلل ووجدنا أن المخزن المؤقت Clarity OTX كان الأكثر توافقًا مع RT-qPCR. لإثبات هذا التوافق ، أنشأنا ملفات تعريف التعبير الخاصة بلوحة صغيرة من mRNAs الخاصة بالأنسجة التي تم الحصول عليها عن طريق تعريض محللات الأنسجة المخففة (الشكل 1 أ ، الجدول التكميلي S1) مباشرة في تفاعل RT-qPCR. قمنا أيضًا بقياس مستويات الجينوم 18S في المحللة بواسطة qPCR واستخدمنا هذه الإشارات المرجعية الداخلية لتطبيع إشارات mRNA التي تم الحصول عليها. تم تأكيد توافق المخزن المؤقت لتحلل الأنسجة مع RT-qPCR مع العديد من ملفات تعريف التعبير المحددة: اقتصر بروتين ربط عامل النمو الشبيه بالأنسولين 1 (IGFBP-1) مرنا على الكبد والكلى (19) ، سلسلة ميوسين الثقيلة 6 (Myh6 ) لا يمكن الكشف عن mRNA إلا في المحللات المعدة من القلب والرئة (20) ويمكن اكتشاف بروتين الميلين الأساسي المشفر للـ mRNA (Mbp) (21) حصريًا في الدماغ. كما هو متوقع ، لوحظت أنماط تعبير مماثلة عند إجراء تفاعلات RT-qPCR باستخدام RNA الكلي المنقى (الشكل التكميلي S2 ، الجدول التكميلي S2).

التوزيع الحيوي للـ mRNAs الداخلية والخارجية الخاصة بالأنسجة. ( أ ) تم التحقق من توافق المخزن المؤقت لتحلل الأنسجة من خلال توصيف ملفات تعريف التعبير عن mRNAs الخاصة بالأنسجة: بروتين ملزمة لعامل النمو الشبيه بالأنسولين 1 (IGFBP1) ، سلسلة ثقيلة Myosin 6 (Myh6) وبروتين Myelin الأساسي (Mbp) في lysates محضر من الغدة الصعترية (Th) والرئة (Lu) والقلب (H) والعضلات الهيكلية (SM) والكلى (K) والدماغ (B) والكبد (Li) والطحال (S). تم تطبيع الإشارات مقابل 18S الجينومي وتم ضبط الحد الأقصى للإشارة المتوسطة لكل mRNA على 100 ٪. ( ب ) يتميز التوزيع الحيوي WBS-PCR للـ mRNAs في (أ). يمثل WBS (اللوحة العلوية) قسم الجسم بالكامل قبل التحلل. شرح الأنسجة: الدماغ (B) والحبل الشوكي (Sc) والغدة اللعابية (Sg) والقلب (H) والكبد (Li) والدم (Bd) والجهاز الهضمي (GI). تم تطبيع جميع الإشارات مقابل 18S الجينومية (اللوحة السفلية). ( ج ) WBS-PCR التوزيع الحيوي للجنين البشري المميت ، الرؤية غير الطبيعية ، ذبابة الفاكهة 1 (ELAVL1) ، الأكتين البشري (Actb) و glyceraldehyde 3-phosphate dehydrogenase (GAPDH) mRNAs في HCT-116 الإنسان الحامل للورم. شرح الأنسجة في WBS: العين (E) ، الدماغ (B) ، الكبد (Li) ، الجهاز الهضمي (GI) ورم HCT-116 (T). تم تطبيع جميع الإشارات مقابل 18S الجينومي (اللوحة السفلية).

التوزيع الحيوي للـ mRNAs الداخلية والخارجية الخاصة بالأنسجة. ( أ ) تم التحقق من توافق المخزن المؤقت لتحلل الأنسجة من خلال توصيف ملفات تعريف التعبير عن mRNAs الخاصة بالأنسجة: بروتين ملزمة لعامل النمو الشبيه بالأنسولين 1 (IGFBP1) ، سلسلة ثقيلة Myosin 6 (Myh6) وبروتين Myelin الأساسي (Mbp) في lysates محضر من الغدة الصعترية (Th) والرئة (Lu) والقلب (H) والعضلات الهيكلية (SM) والكلى (K) والدماغ (B) والكبد (Li) والطحال (S). تم تطبيع الإشارات مقابل 18S الجينومي وتم ضبط الحد الأقصى للإشارة المتوسطة لكل mRNA على 100 ٪. ( ب ) يتميز التوزيع الحيوي WBS-PCR للـ mRNAs في (أ). يمثل WBS (اللوحة العلوية) قسم الجسم بالكامل قبل التحلل. شرح الأنسجة: الدماغ (B) والحبل الشوكي (Sc) والغدة اللعابية (Sg) والقلب (H) والكبد (Li) والدم (Bd) والجهاز الهضمي (GI). تم تطبيع جميع الإشارات مقابل 18S الجينومي (اللوحة السفلية). ( ج ) WBS-PCR التوزيع الحيوي للجنين البشري المميت ، الرؤية غير الطبيعية ، ذبابة الفاكهة 1 (ELAVL1) ، الأكتين البشري (Actb) و glyceraldehyde 3-phosphate dehydrogenase (GAPDH) mRNAs في HCT-116 الإنسان الحامل للورم. شرح الأنسجة في WBS: العين (E) ، الدماغ (B) ، الكبد (Li) ، الجهاز الهضمي (GI) ورم HCT-116 (T). تم تطبيع جميع الإشارات مقابل 18S الجينومي (اللوحة السفلية).

كخطوة تالية ، تم التحقيق في التوزيع الحيوي لنفس لوحة أهداف mRNA باستخدام طريقة WBS-PCR (الشكل 1 ب). تمت مراقبة كفاءة إجراء الاستخراج عن طريق قياس إشارات الجينوم 18S عبر قسم الجسم بالكامل (الشكل 1 ب ، اللوحة السفلية). كما هو متوقع ، أظهر جينوم 18S نمط توزيع حيوي متجانس شامل مع بعض المستويات المرتفعة التي لوحظت في الدماغ. يمكن أن تكون هذه المستويات المرتفعة بسبب الاختلافات في كثافة خلايا الأنسجة وكفاءة الاستخراج. للتعويض عن هذه التحيزات المحتملة ، يتم تصحيح جميع إشارات WBS-PCR مقابل 18S الجينومي. على عكس 18S الجينومي ، عرضت أهداف mRNA أنماط توزيع حيوي أكثر تميزًا والتي أيدت ملامح التعبير التي تم الحصول عليها لمجانسات الأنسجة في جميع الحالات. تم الحصول على نمط التوزيع الحيوي الذي تم الحصول عليه من أجل IGFBP-1 mRNA مع الكبد ، في حين أن إشارات Myh6 mRNA كانت مترجمة مع منطقة القلب فقط. ومن المثير للاهتمام ، أن نمط التوزيع الحيوي Mbp أكد تعبير الرنا المرسال في الدماغ ولكن بشكل مثير للاهتمام أيضًا في مناطق على طول الحبل الشوكي. مفتونًا بهذه الملاحظة ، تكرر تفاعل RT-qPCR على الحمض النووي الريبي الكلي المنقى (الشكل التكميلي S2 والجدول التكميلي S2) ، ويمكن تأكيد وجود Mbp mRNA في كل من الدماغ والحبل الشوكي. توضح هذه الملاحظة قوة WBS-PCR في تصور التوزيع الحيوي للـ mRNAs غير المميزة.

لمزيد من التحقق من الدقة الضوئية التي يمكن تحقيقها باستخدام WBS-PCR ، قمنا بالتحقيق في نمط التوزيع الحيوي للـ mRNAs البشري الذي يشفر ELAVL1 (رؤية جنينية مميتة ، غير طبيعية ، تشبه ذبابة الفاكهة 1) ، Actb (بيتا أكتين) و GAPDH (glyceraldehyde-3 -فوسفات ديهيدروجينيز) في قسم تم الحصول عليه من ورم بشري (HCT-116) - يحمل فأرًا (الشكل 1 ج) باستخدام بادئات RT-qPCR الخاصة بالإنسان. كما هو متوقع ، فإن نمط التوزيع الحيوي للـ mRNAs البشري قد تم تحديده بشكل مشترك مع منطقة نمو الورم. نظرًا لأن الاشعال 18S يتعرف على كل من تسلسل الإنسان والفأر ، يمكن اكتشاف الجينوم 18S عبر القسم بمستويات مرتفعة في منطقة الورم (الشكل 1 ج ، اللوحة السفلية). مجتمعة ، تشير هذه البيانات إلى أن تفكيك قسم الماوس لكامل الجسم إلى 363 عينة منفصلة متبوعًا بإعادة تجميع إشارات RT-qPCR في صورة يمكن أن يولد بيانات توزيع بيولوجي دقيقة قابلة للتفسير وقد يوفر معلومات تعبيرية أكثر تفصيلاً مما يمكن مشتق من أنسجة معزولة بشكل فردي.

مسح الجسم بالكامل PCR لتوطين miRNAs و siRNAs

تم الحصول على بيانات التوزيع الحيوي لـ RNA المذكورة أعلاه باستخدام مقايسة TaqMan شديدة التحديد ، والتي تعتمد على التضخيم المحدد للجين المستهدف باستخدام اثنين من البادئات والتحليل المائي لمسبار TaqMan. على الرغم من وصف فحوصات مماثلة قائمة على التحقيق للكشف عن siRNAs (22 ، 23) ، فقد شرعنا في تطوير مقايسة RT-qPCR بهدف تقليل كمية خطوات معالجة العينة دون المساس بخصوصية الاختبار أو حساسيته (الشكل 2 أ. ). مثل معظم المقايسات ، تعتمد الخطوة الأولى على التحويل الكلاسيكي للحمض النووي الريبي إلى (كدنا) عن طريق تمديد التمهيدي بوساطة النسخ العكسي (24). في الخطوة الثانية ، تتم إضافة مزيج qPCR مباشرة إلى تفاعل النسخ العكسي المعطل بالحرارة متبوعًا بتفاعل PCR في الوقت الفعلي قائم على إخماد التمهيدي (25). يتم تحديد كمية الفلورسنت في الوقت الحقيقي أثناء دورة التمديد لتفاعل تفاعل البوليميراز المتسلسل. خلال هذه الدورة ، سيتم إخماد البادئات الأمامية غير المدمجة بواسطة البادئة المضادة التي تحمل علامات التبريد بينما لن يتم إخماد البادئات الأمامية التي تشكل منتجات PCR مزدوجة الشريطة. ستكون إشارة الفلورسنت المتزايدة بشكل كبير نتيجة لتضخيم الهدف الناجح. نظرًا لأن miRNAs و siRNAs متشابهة في الحجم وبالتالي تشكل تحديات مماثلة فيما يتعلق بتصميم الاشعال الموثوق به ، فقد تم تقييم خصوصية الفحص في دراسة مصفوفة نموذجية حيث تم قياس مستوى التفاعل المتبادل مقابل لوحة ذات صلة وثيقة Let-7 أفراد عائلة ميرنا (الشكل 2 ب).مع الأخذ في الاعتبار أن الهدف المطابق تمامًا تم تعيينه بشكل تعسفي عند 100٪ ، لوحظ أعلى تفاعل تبادلي (∼3٪) فقط عندما تم تحديد مستويات Let-7d و Let-7b باستخدام مواد أولية مصممة ضد Let-7a أو Let-7c ، على التوالى. أدت جميع تركيبات القالب / التمهيدي الأخرى إلى الحد الأدنى من التفاعل التبادلي الذي يتراوح بين 0 و 1٪. تم الإبلاغ عن مستويات مماثلة من الخصوصية باستخدام مقايسات TaqMan miRNA المتاحة تجارياً (26). بالإضافة إلى ذلك ، عرضت جميع فحوصات Let-7 نطاقًا ديناميكيًا كبيرًا (8-10 سجلات) مع حد أدنى للاكتشاف يتراوح من 0.02 إلى 0.002 فيمتوجرام ، مما يبرز مستوى الحساسية الذي يمكن تحقيقه باستخدام اختبار RT-qPCR هذا (الشكل التكميلي S3). تم تمييز أداء اختبار RT-qPCR أيضًا عن طريق قياس مستويات التعبير النسبي للوحة من miRNAs في نفس متجانسات عضو الماوس الموصوفة سابقًا (الشكل 2 ج والجدول التكميلي S3). كما هو متوقع ، الكشف عن miRNAs الخاصة بالقلب والعضلات (مثل miR-208a و miR-1a و miR-133a) والكبد (على سبيل المثال miR-122) والميرنا المخصب بالدماغ (مثل miR-124 ، تؤكد miR-127 و miR-128 و miR-132 و miR-137 و miR-139 في الأعضاء المناسبة (27-29) توافق طريقتنا مع قياس miRNAs مباشرةً في محللات الأنسجة. بالإضافة إلى ذلك ، أدى تحليل RT-qPCR لـ miRNA 122-5p و 208a-3p و 124-3p و 124-5p و 191-5p و 16-5p باستخدام إجمالي الحمض النووي الريبي كمدخل في التفاعل إلى ملفات تعريف تعبير مماثلة (الشكل التكميلي) S4 والجدول التكميلي S4). مجتمعة ، تشير البيانات بقوة إلى أن إجراء التحلل متوافق بالفعل مع الكشف المحدد عن miRNAs المشتقة من الأنسجة.

توصيف والتحقق من صحة طريقة ميرنا RT-qPCR ( أ ) مقايسة RT-qPCR لميرناس و siRNAs. يتم استخدام التمهيدي RT / العكسي لإنشاء نسخة (كدنا) من قالب الحمض النووي الريبي أثناء خطوة النسخ العكسي. يحدث القياس الكمي الفلوري في الوقت الحقيقي أثناء خطوة qPCR بمساعدة التهجين التمهيدي المسمى بـ fluorescently إلى الأمام التمهيدي RT / Reverse. يتم إخماد الإشارات الناتجة عن البادئات الأمامية غير المدمجة بواسطة مادة منع الحمل التمهيدي المسمى بـ quencher. ( ب ) تم التحقق من خصوصية طريقة RT-qPCR من خلال تحليل شدة إشارة الأرض الخلفية الناتجة عن الاشعال الخاص بـ let-7 miRNA باستخدام إما Let-7a ، -7b ، -7c ، -7d ، -7e ، -7f ، - 7g ، -7i كقالب في التفاعل. تم تعيين القيم المتوسطة للأهداف المتطابقة تمامًا عند 100٪. أشرطة الخطأ ، STDEV ( ن = 4). ( ج ) ملف تعبير ميرنا في متجانسات الأنسجة المخففة: الغدة الصعترية (ث) والرئة (لو) والقلب (ح) والعضلات الهيكلية (SM) والكلى (ك) والدماغ (ب) والكبد (لي) والطحال (س). تم تطبيع الإشارات مقابل 18S الجينومي ، وتم ضبط الحد الأقصى للإشارة المتوسطة لكل mRNA على 100٪.

توصيف والتحقق من صحة طريقة ميرنا RT-qPCR ( أ ) مقايسة RT-qPCR لميرناس و siRNAs. يتم استخدام التمهيدي RT / العكسي لإنشاء نسخة (كدنا) من قالب الحمض النووي الريبي أثناء خطوة النسخ العكسي. يحدث القياس الكمي الفلوري في الوقت الحقيقي أثناء خطوة qPCR بمساعدة التهجين التمهيدي المسمى بـ fluorescently إلى الأمام التمهيدي RT / Reverse. يتم إخماد الإشارات المتولدة من البادئات الأمامية غير المدمجة بواسطة مادة منع الحمل التي تحمل علامات إخماد التمهيدي. ( ب ) تم التحقق من خصوصية طريقة RT-qPCR من خلال تحليل شدة إشارة الأرض الخلفية الناتجة عن الاشعال الخاص بـ let-7 miRNA باستخدام إما Let-7a ، -7b ، -7c ، -7d ، -7e ، -7f ، - 7g ، -7i كقالب في التفاعل. تم تعيين القيم المتوسطة للأهداف المتطابقة تمامًا عند 100٪. أشرطة الخطأ ، STDEV ( ن = 4). ( ج ) ملف تعبير ميرنا في متجانسات الأنسجة المخففة: الغدة الصعترية (ث) والرئة (لو) والقلب (ح) والعضلات الهيكلية (SM) والكلى (ك) والدماغ (ب) والكبد (لي) والطحال (س). تم تطبيع الإشارات مقابل 18S الجينومي ، وتم ضبط الحد الأقصى للإشارة المتوسطة لكل mRNA على 100٪.

تم دعم خصوصية اختبار RT-qPCR بشكل إضافي من خلال أنماط التوزيع الحيوي التي تم الحصول عليها من أجل miRNAs الخاصة بالأنسجة miR-122 (الكبد) و miR-208a (القلب) و miR-124-3p / -5p (الدماغ) ، و أعرب في كل مكان عن miRNAs miR-191 و miR-16 ، باستخدام طريقة WBS-PCR (الشكل 3 أ). مرة أخرى ، تم استخدام الجينوم 18S لتأكيد كفاءة الاستخراج ولتطبيع جميع إشارات ميرنا (الشكل 3 ، اللوحة السفلية). ومن المثير للاهتمام ، أن التعبير عن miR-124-3p و miR-124-5p ، وكلاهما تمت معالجتهما من نفس الحمض النووي الريبي ، أظهر أنماط توزيع حيوي متشابهة جدًا خاصة بالدماغ.

التوزيع الحيوي لل miRNAs الخاصة بالأنسجة و siRNA الخارجي المسمى التريتيوم. ( أ ) التوزيع الحيوي لل miRNAs الخاصة بالأنسجة باستخدام WBS-PCR. شرح الأنسجة: الدماغ (B) والقلب (H) والكبد (Li) والمعدة (St) والجهاز الهضمي (GI). تم تطبيع جميع الإشارات مقابل 18S الجينومي (اللوحة السفلية). ( ب ) التوزيع الحيوي لمركب siRNA غير المشكل المسمى التريتيوم والذي يستهدف Mrp4 بالتصوير الفوسفوري (QWBA) و WBS-PCR (Mrp4 siRNA) عند 10 دقائق بعد الجرعات (كلما كانت المنطقة أكثر بياضًا في التصوير الشعاعي التلقائي باستخدام QWBA ، كلما زاد تركيز النشاط الإشعاعي) وكذلك تم الحصول على تصور WBS-PCR للتوزيع الحيوي الذي تم الحصول عليه لـ miR-191. تم تطبيع جميع إشارات miRNA و siRNA مقابل 18S الجينومي (اللوحة السفلية). ( ج ) حد الكشف عن مقايسة RT-qPCR باستخدام 3′-truncated (اللوحة العلوية) ، 5′-truncated (اللوحة الوسطى) و 3 ′ / 5′-truncated (اللوحة السفلية) Mrp4 المضادة للحواس كقالب في التفاعل.

التوزيع الحيوي لل miRNAs الخاصة بالأنسجة و siRNA الخارجي المسمى التريتيوم. ( أ ) التوزيع الحيوي لل miRNAs الخاصة بالأنسجة باستخدام WBS-PCR. شرح الأنسجة: الدماغ (B) والقلب (H) والكبد (Li) والمعدة (St) والجهاز الهضمي (GI). تم تطبيع جميع الإشارات مقابل 18S الجينومي (اللوحة السفلية). ( ب ) التوزيع الحيوي لمركب siRNA غير المشكل المسمى التريتيوم والذي يستهدف Mrp4 عن طريق التصوير الفوسفوري (QWBA) و WBS-PCR (Mrp4 siRNA) عند 10 دقائق بعد الجرعات (كلما كانت المنطقة أكثر بياضًا في التصوير الشعاعي التلقائي باستخدام QWBA ، زاد تركيز النشاط الإشعاعي) وكذلك تم الحصول على تصور WBS-PCR للتوزيع الحيوي الذي تم الحصول عليه لـ miR-191. تم تطبيع جميع إشارات miRNA و siRNA مقابل 18S الجينومي (اللوحة السفلية). ( ج ) حد الكشف عن مقايسة RT-qPCR باستخدام 3′-truncated (اللوحة العلوية) ، 5′-truncated (اللوحة الوسطى) و 3 ′ / 5′-truncated (اللوحة السفلية) Mrp4 المضادة للحواس كقالب في التفاعل.

كاختبار أكثر صرامة ، قمنا بمقارنة نمط التوزيع الحيوي لطريقة WBS-PCR مع التصوير الشعاعي الكمي التقليدي لكامل الجسم (QWBA) الذي تم الحصول عليه من فأر تم حقنه عن طريق الوريد بجرعة siRNA غير مُصاغة من التريتيوم والتي تستهدف بروتين المقاومة للأدوية المتعددة 4 (Mrp4) سيرنا) (10) (الشكل 3 ب والشكل التكميلي S5). كشف تحليل قسم الماوس ، الذي تم التضحية به لمدة 10 دقائق بعد الجرعات الوريدية ، أن المستويات العالية من المكونات التي تحمل علامات إشعاعية الكلية التي لوحظت في الكلى والكبد ، والتي تمثلها المناطق البيضاء في التصوير الشعاعي التلقائي باستخدام QWBA ، كانت موجودة أيضًا في نمط التوزيع الحيوي الذي تم الحصول عليه باستخدام WBS طريقة PCR. على الرغم من وجود نشاط إشعاعي في الغدة اللعابية ، فشل WBS-PCR في تأكيد وجود سيرنا في هذا العضو. لا يمكن أن يُعزى نقص إشارة siRNA RT-qPCR إلى ضعف كفاءة الاستخراج بسبب الوجود الواضح لكل من الجينوم 18S و miR-191 في هذه المنطقة. في الواقع ، أكد تحليل LC-MS أن الإشارة المشعة التي لوحظت في الغدة اللعابية لا تمثل إشارة siRNA السليمة بل تمثل إشارة المستقلب أحادي Uridine (البيانات غير معروضة). للتحقيق في حدود RT-qPCR فيما يتعلق باكتشاف المستقلبات ، أنشأنا عمليات اقتطاع مختلفة من الخيط المضاد للمعنى من مزدوج سيرنا مزدوج ، ورفعها إلى RNA إجمالي الفئران وحددنا لكل قالب أقل قدر من الهدف الذي لا يزال من الممكن أن يكون يمكن الكشف عنها بواسطة RT-qPCR (الشكل 3 ج). كما هو متوقع ، ينتج عن حذف أكثر من نيوكليوتيدات في نهاية التسلسل المستهدف 5 ′ أو 3 انخفاضًا سريعًا في حساسية اختبار RT-qPCR. وبالتالي ، لن يتم أيضًا اكتشاف المستقلبات مثل mono-Uridine بواسطة RT-qPCR. تؤكد هذه البيانات مجتمعة أن الإشارات التي تم الحصول عليها في WBS-PCR تنشأ إما من RNA كامل الطول أو مستقلبات مقطوعة إلى الحد الأدنى. بالإضافة إلى ذلك ، فإن عدم الكشف عن المستقلبات ، مثل mono-Uridine ، يوفر خصوصية إشارة ، بينما يوفر نهج QWBA الكلاسيكي اكتشاف النشاط الإشعاعي الكلي من المركبات الأم والمستقلبات.

مسح PCR للجسم بالكامل من أجل توطين قليلات النوكليوتيدات المعدلة كيميائياً

تحتوي معظم قليل النوكليوتيدات العلاجية على درجات مختلفة من التعديلات الكيميائية لإضفاء الخصائص المناسبة مثل مقاومة نوكلياز ، وألفة ، وخصوصية ، وأمان ، وتوزيع ، وامتصاص خلوي. على الرغم من أن التعديلات الكيميائية يمكن أن تحسن الخصائص الدوائية والديناميكية لهذه الأوليغنوكليوتيدات ، إلا أنها تشكل أيضًا تحديات تحليلية. على سبيل المثال ، 2′- ا - يمكن اكتشاف قليل النوكليوتيد المعدل للميثيل -16 (AMO-miR-16) بسهولة بواسطة RT-qPCR (30) في حين أن 2′- ا - (2-ميثوكسي إيثيل) - التسلسل المعدل ليس (الشكل التكميلي S6). لهذا السبب ، قمنا بتطوير مقايسة CL-qPCR من خطوتين التي تستخدم qPCR لتحديد كمية المنتج المتكون في ربط كيميائي ذاتي التوجيه لاثنين من مركبات oligodeoxynucleotides مقولبة بواسطة التحليل التكميلي بالكامل (11 ، 31) (تكميلي) الشكل S7a) ، بصرف النظر عن التسلسل (الشكل التكميلي S7b) أو التعديلات الكيميائية الموجودة في القالب (الشكل التكميلي S8). أثناء الخطوة الأولى ، يؤدي ربط اثنين من أليغنوكليوتيدات الحمض النووي ، جنبًا إلى جنب ، على الهدف إلى بدء تفاعل مجموعة فوسفوروثيوات النيوكليوفيليك ، الموجودة على الطرف 3′ لواحد من قليل النوكليوتيد ، مع الكربون المحب للكهرباء عند 5′- نهاية قليل النوكليوتيد المجاور. ينتج عن هذا التفاعل المعتمد على القرب إزاحة المجموعة التي تترك الكبريتات وتشكيل رابطة كربون-كبريت ، تربط تساهميًا بين قليل النوكليوتيدات في حمض نووي واحد فريد من نوعه (الشكل 4 أ) ، والذي يمكن قياسه بواسطة تفاعل البوليميراز المتسلسل (PCR) ، على الرغم من تكون الرابطة الكربونية والكبريتية أطول إلى حد ما من رابطة الكربون والأكسجين للحمض النووي العادي.

التحقق من صحة التوزيع الحيوي الذي تم الحصول عليه لـ AMO-miR-16 باستخدام CL-qPCR. ( أ ) تفاعل كيميائي يحدث أثناء التهجين المستهدف جنبًا إلى جنب من DNA-oligo الذي يحتوي على مجموعة 3′-phosphorothioate ومجموعة DNA-oligo تحتوي على مجموعة 5′-biphenylsulphonlyl. ينتج عن التفاعل بوساطة القالب والمعتمد على القرب إزاحة مجموعة ترك ثنائي الفينيل سلفونيل وتشكيل رابطة كربون-كبريت. (تمثل BASE الأدينوزين أو الجوانوزين أو الثيميدين أو السيتيدين). ( ب ) القياس الكمي لـ AMO-miR-16 في البلازما المعزولة من AMO-miR-16- (أسود) والفئران المعالجة بـ PBS (الرمادية). القيم هي متوسط ​​القياسات الثلاثية من خمسة حيوانات. أشرطة الخطأ ، sem ( ن = 15). * ص & lt 0.05 (اختبار مجموع تصنيف مان ويتني). ( ج ) تم تحديد التوزيع الحيوي لـ miR-16 و AMO-miR-16 في أقسام الجسم بالكامل للماوس ، وتم التعامل معها إما باستخدام AMO-miR-16 (اللوحة اليسرى) أو باستخدام PBS (اللوحة اليمنى) وتم تطبيعها مقابل 18S الجينومية. شرح الأنسجة: العين (E) ، الدماغ (B) ، الرئة (Lu) ، القلب (H) ، الكبد (Li) ، المعدة (St) ، الكلى (K) ، العظام (Bo) والجهاز الهضمي (GI) . ( د - و ) القياس الكمي لـ AMO-miR-16 (d) و miR-16 (e) و miR-191 (f) في الأنسجة المعزولة عن الفئران المعالجة إما بـ AMO-miR-16 (أسود) أو PBS (رمادي). القيم هي متوسط ​​القياسات الثلاثية من أربعة حيوانات. أشرطة الخطأ ، sem ( ن = 12). * ص & lt 0.05 [اختبار مجموع تصنيف مان ويتني (د و هـ) ، ر -test (f)، n.s .: not important].

التحقق من صحة التوزيع الحيوي الذي تم الحصول عليه لـ AMO-miR-16 باستخدام CL-qPCR. ( أ ) تفاعل كيميائي يحدث أثناء التهجين المستهدف جنبًا إلى جنب من DNA-oligo الذي يحتوي على مجموعة 3′-phosphorothioate ومجموعة DNA-oligo تحتوي على مجموعة 5′-biphenylsulphonlyl. ينتج عن التفاعل بوساطة القالب والمعتمد على القرب إزاحة مجموعة ترك ثنائي الفينيل سلفونيل وتشكيل رابطة كربون-كبريت. (تمثل BASE الأدينوزين أو الجوانوزين أو الثيميدين أو السيتيدين). ( ب ) القياس الكمي لـ AMO-miR-16 في البلازما المعزولة من AMO-miR-16- (أسود) والفئران المعالجة بـ PBS (الرمادية). القيم هي متوسط ​​القياسات الثلاثية من خمسة حيوانات. أشرطة الخطأ ، sem ( ن = 15). * ص & lt 0.05 (اختبار مجموع تصنيف مان ويتني). ( ج ) تم تحديد التوزيع الحيوي لـ miR-16 و AMO-miR-16 في أقسام الجسم بالكامل للماوس ، وتم التعامل معها إما باستخدام AMO-miR-16 (اللوحة اليسرى) أو باستخدام PBS (اللوحة اليمنى) وتم تطبيعها مقابل 18S الجينومية. شرح الأنسجة: العين (E) ، الدماغ (B) ، الرئة (Lu) ، القلب (H) ، الكبد (Li) ، المعدة (St) ، الكلى (K) ، العظام (Bo) والجهاز الهضمي (GI) . ( د - و ) القياس الكمي لـ AMO-miR-16 (d) و miR-16 (e) و miR-191 (f) في الأنسجة المعزولة عن الفئران المعالجة إما بـ AMO-miR-16 (أسود) أو PBS (رمادي). القيم هي متوسط ​​القياسات الثلاثية من أربعة حيوانات. أشرطة الخطأ ، sem ( ن = 12). * ص & lt 0.05 [اختبار مجموع تصنيف مان ويتني (د و هـ) ، ر -test (f)، n.s .: not important].

بعد ذلك ، قمنا بالتحقيق في التوزيع الحيوي لـ AMO-miR-16 المعدلة بواسطة MOE باستخدام CL-qPCR. لهذا الغرض ، تم حقن مجموعتين من الفئران ، تتكون كل منهما من خمسة حيوانات ، عن طريق الوريد باستخدام AMO-miR-16 (80 مجم / كجم) أو PBS. تم جمع عينات البلازما في نقاط زمنية مختلفة على مدار 24 ساعة ، وتم تحديد مستويات AMO-miR-16 باستخدام طريقة CL-qPCR. كما هو متوقع ، تم تطهير AMO-miR-16 بسرعة من البلازما لتصل إلى مستويات لا يمكن اكتشافها خلال ساعة واحدة بعد الجرعات (الشكل 4 ب والشكل التكميلي S9). على الرغم من التصفية السريعة للبلازما ، كشف WBS-PCR في الأقسام التي تم الحصول عليها على مدار 24 ساعة بعد الجرعات عن نمط توزيع حيوي واسع لـ AMO-miR-16 ، مما يشير إلى امتصاص واسع النطاق لـ AMO-miR-16 في مجموعة متنوعة من الأنسجة (الشكل 4 ج). يمكن ملاحظة أعلى مستويات AMO-miR-16 في الكلى بينما لا يمكن اكتشاف أي إشارة في العينات التي تتواجد في مكان واحد مع الدماغ. ومن المثير للاهتمام ، أن أليغنوكليوتيد PO معدل 20 ميكرومترًا يستهدف جزيء الالتصاق بين الخلايا البشري -1 مرنا في الجرذان يعرض ملفًا مشابهًا للحركية الدوائية للبلازما ونمط التوزيع الحيوي ، مما يؤكد أداء CL-qPCR (32). بالإضافة إلى ذلك ، خفضت جرعات AMO-miR-16 مستويات التوزيع الحيوي العالمية لـ miR-16 في الحيوان المعالج AMO-miR-16 مقارنةً بتلك الموجودة في الحيوان المعالج بـ PBS. من ناحية أخرى ، كان التوزيع الحيوي لـ genomic 18S متشابهًا جدًا بين الحيوانين ولم يشر إلى أن نقص miR-16 قد يكون بسبب ضعف كفاءة الاستخراج. لتأكيد ملاحظة WBS-PCR ، تم قياس AMO-miR-16 (الشكل 4 د والشكل التكميلي S10) ومستويات miR16 (الشكل 4 هـ والشكل التكميلي S11) في الأعضاء المعزولة من الحيوانات الأربعة المتبقية. في الواقع ، أكد التقدير الكمي لـ AMO-miR-16 بواسطة CL-qPCR وجود المركب في الكلى والكبد والرئة والطحال ولكن ليس في دماغ الحيوانات المعالجة. كما أدى وجود AMO-miR-16 إلى خفض مستويات miR-16 بشكل كبير في هذه الأنسجة بينما ظلت مستويات miR-191 (الشكل 4 f والشكل التكميلي S12) غير متأثرة ، مما يشير إلى أن فقدان miR-16 قد يكون بالفعل نتيجة لـ AMO ربط. تؤكد هذه البيانات مجتمعة على متانة طريقة CL-qPCR في القياس الكمي لأوليغنوكليوتيدات المعدلة كيميائيًا بشكل كبير في العينات البيولوجية وتطبيقها في دراسات التوزيع الحيوي باستخدام WBS-PCR.


تأثير مستويات البنية على تشتت Raman المعزز سطحًا لمضاعفات G-quadruplex التيلوميرية البشرية في الوسائط المخففة والمزدحمة

إن التيلوميرات البشرية G-quadruplexes هي أهداف ناشئة في اكتشاف الأدوية المضادة للسرطان لأنها قادرة على تثبيط التيلوميراز بكفاءة ، وهو إنزيم يشارك بشكل كبير في عدم استقرار التيلومير وعملية الخلود في الخلايا الخبيثة. إن الحمض النووي G-quadruplex (G4) متعدد الأشكال للغاية ويمكن أن يتبنى طوبولوجيا مختلفة عند إضافة الإلكتروليتات والإضافات والروابط. ومع ذلك ، قد تكون دراسة أشكال G-quadruplex في ظل ظروف مختلفة صعبة للغاية. في هذا العمل ، تم تطبيق التحليل الطيفي لتشتت رامان (SERS) المعزز على السطح لدراسة G-quadruplexes المتكونة من متواليات تيلوميرية بشرية ، د [A3جي3(TTAGGG)3أ2] (Tel26) و d [(TTAGGG)4تي2] (wtTel26) ، في ظل ظروف مخففة وازدحام. تمت ملاحظة أطياف SERS المميزة للهجين الهجين -1 والهجين -2 G-quadruplexes من Tel26 و wtTel ، على التوالي ، للتسلسلات المطوية في وجود أيونات K + (110 ملم) في محلول مخزّن ، يمثل الوسط المخفف. بولي إيثيلين جلايكول (5 ، 10 ، 15 ، 20 ، 40٪ الخامس/الخامس تم استخدام PEG) لإنشاء بيئة مزدحمة جزيئيًا ، مما أدى إلى تكوين G-quadruplexes المتوازية لكل من متواليات التيلوميرات البشرية المدروسة. على الرغم من التداخل الواسع من قبل نطاقات عامل الازدحام ، تم التعرف على الميزات الطيفية SERS التي تدل على شكل G4 المتوازي من Tel26. أشارت النتائج التي تم الحصول عليها إلى أن SERS لـ G-quadruplexes لا تعكس فقط البنية الأولية لتسلسل التيلوميرات البشرية المدروسة ، بما في ذلك تكوين القاعدة النووية وتسلسلها ، ولكن أيضًا هيكلها الثانوي بمعنى روابط Hoogsteen الهيدروجينية المسؤولة عن تكوين رباعي الجوانين ، و أخيرًا هيكلها الثلاثي ، الذي يحدد شكل DNA ثلاثي الأبعاد ، موضوع بالقرب من السطح المعدني المعزز.

هذه معاينة لمحتوى الاشتراك ، والوصول عبر مؤسستك.


ما هي تكلفة أليغنوكليوتيد 5 'pGpGpApCpT 3' عند الرقم الهيدروجيني 7.00؟ - مادة الاحياء

مجلة Open Journal of Applied Biosensor المجلد 03 رقم 02 (2014) ، معرف المقالة: 46020،8 صفحة
10.4236 / ojab.2014.32002

الكشف عن جين سرطان الثدي 1 (BRCA1) باستخدام جهاز استشعار حيوي كهروكيميائي للحمض النووي يعتمد على أسلاك ZnO النانوية المعطلة

نور عزيمة منصور 1 ، زينهرياتي محمد زين 1 ، هيرول هشام حمزة 1 ، محمد شهاب الدين أحمد نوردين 2 ، 3 ، سيتي سافورا جابار 2 ، فاليريو بني 4 ، ظفر حسين إيبوبوتو 5

1 كلية العلوم التطبيقية ، جامعة مارا التكنولوجية ، شاه علم ، ماليزيا

2 كلية الصيدلة ، جامعة مارا التكنولوجية ، بونشاك علم ، ماليزيا

3 معهد عطا الرحمن لاكتشاف المنتجات الطبيعية ، جامعة مارا للتكنولوجيا ، بونشاك ألام ، ماليزيا

4 مركز المستشعرات الحيوية والإلكترونيات الحيوية ، قسم الفيزياء والكيمياء والبيولوجيا ، جامعة Link & oumlping ، Link & oumlping ، السويد

5 قسم الإلكترونيات الفيزيائية وتكنولوجيا النانو ، قسم العلوم والتكنولوجيا (ITN) ، الحرم الجامعي Norrk & oumlping ، جامعة Link & oumlping ، Norrk & oumlping ، السويد

حقوق النشر والنسخ 2014 للمؤلفين وشركة Scientific Research Publishing Inc.

هذا العمل مُرخص بموجب رخصة المشاع الإبداعي نَسب المُصنَّف (CC BY).

تم استلامه في 14 فبراير 2014 المنقح في 1 أبريل 2014 وتم قبوله في 8 أبريل 2014

هنا نُبلغ عن جهاز استشعار حيوي كهروكيميائي للحمض النووي للكشف السريع عن التسلسل (5 "AAT GGA TTT ATC TGC TCT TCG 3") الخاص بجين سرطان الثدي 1 (BRCA1).يعتمد المستشعر الجيني الكهروكيميائي المقترح على مسبار DNA قصير النوكليوتيد مثبت على أسلاك نانوية من أكسيد الزنك (ZnONWs) تم توليفها كيميائيًا على قطب كهربائي من الذهب عبر تقنية حرارية مائية. أظهرت دراسات مورفولوجيا ZnONWs ، التي تم إجراؤها بواسطة المجهر الإلكتروني لمسح انبعاث الحقل (FESEM) ، أن أسلاك ZnO متجانسة وكثيفة للغاية وموجهة بشكل عمودي على الركيزة. تم التحقيق في حدث التعرف بين مسبار الحمض النووي والهدف عن طريق قياس الجهد التفاضلي (DPV) في محلول عازلة خلات 0.1 M (ABS) ، ودرجة الحموضة 7.00 نتيجة للتهجين ، ولوحظت إشارة أكسدة عند +0.8 فولت. تم فحص الأس الهيدروجيني والتركيز المستهدف والحمض النووي غير التكميلي على أداء جهاز الاستشعار الحيوي. جهاز الاستشعار البيولوجي المقترح للحمض النووي لديه القدرة على اكتشاف التسلسل المستهدف في نطاق التركيز بين 10.0 و 100.0 و microM بحد كشف يبلغ 3.32 و microM. أظهرت النتائج التجريبية أن أقطاب ZnONWs / Au المحضرة هي منصة مناسبة لتثبيط الحمض النووي.

أسلاك أكسيد الزنك النانوية ، مستشعر الحمض النووي الحيوي ، جين سرطان الثدي ، BRCA1 ، تهجين الحمض النووي ، التفاضل

يعد سرطان الثدي ، الذي يصيب بشكل أساسي البطانة الداخلية لمجاري الحليب ، أحد الأسباب الرئيسية للوفاة في عصرنا. تعتبر النقائل البعيدة السبب الرئيسي للوفاة ، لذا فإن التشخيص في مرحلة مبكرة ، وبالتالي العلاج ، مطلوبان بشدة [1]. ارتبط سرطان الثدي بطفرات جينية مختلفة ولكن الطفرات الأكثر شيوعًا ، وكلها مرتبطة بتنشيط خلايا سرطان الثدي ، هي BRCA1 و BRCA2 و p53 والتي حدثت في آليات تصحيح الأخطاء. هذه الطفرات إما وراثية أو مكتسبة بعد الولادة وعادة ما تعزز طفرات أخرى ، مما أدى إلى زيادة سرعة انقسام الخلايا ، ونقص الارتباط وانتشار ورم خبيث للأعضاء البعيدة [2] [3]. سرطان الثدي 1 (BRCA1) هو جين مثبط للورم حيث يشارك بروتين BRCA1 في منع النمو السريع وغير المنضبط للخلايا. تجعل الطفرات في هذا الجين بروتين BRCA1 غير قادر على إصلاح الحمض النووي التالف مما يؤدي بهذه الطريقة إلى نمو الخلايا بشكل لا يمكن السيطرة عليه وتشكيل الورم. تم التعرف على جين BRCA1 في عام 1994 ويقع في المنطقة من 38.449.840 إلى 38.530.994 زوج قائم على النطاق 21 من الكروموسوم 17 [4]. هذا الجين مسؤول عن 40٪ من خطر الإصابة بسرطان الثدي على الناقل [5] [6]. بعد ذلك ، تم اقتراح هذه الطفرات النقطية كمؤشرات حيوية محتملة في الكشف المبكر عن سرطان الثدي وفحصه.

في نهاية المطاف ، هناك حاجة ماسة إلى منصات استشعار خاصة بالموقع للكشف المبكر عن جين سرطان الثدي أثناء الخزعة. ويرجع ذلك إلى حقيقة أن تقنيات الكشف عن الحمض النووي (DNA) الحالية ، مثل النشاف الشمالي ، ومقايسات حماية الريبونوكلياز ، والنسخ العكسي - تفاعل البوليميراز المتسلسل (RT-PCR) وتسلسل الحمض النووي لها العديد من القيود ، بما في ذلك الحساسية المنخفضة ، الانتقائية الضعيفة ، باهظة الثمن وغير خطية لقوة الهدف [7] [8]. لذلك ، ستكون هناك حاجة لأنظمة الكشف عن جينات سرطان الثدي عالية الدقة والسريعة وغير المكلفة والملائمة لدعم الطبيب لرصد تطور المرض المبكر في الأفراد المشتبه بهم. سيسمح هذا أيضًا بالتخطيط لعلاج أكثر ملاءمة للسرطان لتقليل السمية وفقًا لنوع خلية الورم المحدد [9]. يمكن أن يكون تطوير الاستشعار القائم على الحمض النووي بمثابة فحص بديل للعلاج الإرشادي. في السنوات الأخيرة ، حظيت أجهزة الاستشعار الحيوية الكهروكيميائية بالحمض النووي باهتمام كبير ، حيث قدمت استجابات بسيطة ودقيقة وسريعة ، وحساسية عالية ، وانتقائية متأصلة ، وكونها منصة غير مكلفة للكشف الجزيئي [10].

Biosensor عبارة عن جهاز تحليلي مضغوط يحتوي على عنصر تمييز بيولوجي متكامل بشكل وثيق مع محول طاقة فيزيائية كيميائية. المكونات الثلاثة الرئيسية لجهاز الاستشعار البيولوجي هي: عناصر التعرف البيولوجي مثل الإنزيم والحمض النووي والجسم المضاد والحمض النووي ، المحول الذي يحول حدث التعرف البيولوجي إلى إشارة قابلة للقياس الكمي وأخيراً نظام معالجة الإشارات. فئات المحولات الرئيسية الخمسة هي البصري ، والقياس الحراري ، والكهروكيميائي ، والكهربيضغطي ، والمغناطيسي. اكتسب التنبيغ الكهروكيميائي ، نظرًا لحساسيته الأفضل وانتقائيته وقابليته للتكاثر وسهولة صيانته بالإضافة إلى التكلفة المنخفضة ، شعبية كبيرة في أجهزة الاستشعار الحيوية للحمض النووي [11] - [13]. لعبت المستشعرات الحيوية الكهروكيميائية أيضًا دورًا مهمًا في الانتقال نحو جهاز تشخيص نقطة الرعاية كما يتضح من مستشعرات الجلوكوز الموزعة في جميع أنحاء العالم.

يعتمد المبدأ الأساسي لجهاز الاستشعار الحيوي للحمض النووي عادةً على تثبيت مسبار قليل النوكليوتيد (ssDNA) الذي تقطعت به السبل على سطح قطب كهربائي ، مما يوفر الخصوصية تجاه الحمض النووي المستهدف المحدد. يتم بعد ذلك تحويل حدث التعرف ، المستند إلى تهجين الحمض النووي ، إلى إشارة قابلة للقراءة بواسطة محول الطاقة.

يعتمد أداء المستشعر الجيني الكهروكيميائي بشكل كبير على خصائص المواد الداعمة التي يجب أن توفر بيئة جيدة لتثبيت الحمض النووي ، دون المساس بنشاطه البيولوجي ، وتوفير قدرات نقل جيدة [14]. في الوقت الحالي ، أصبح استخدام المواد النانوية في مجال المستشعر الحيوي أحد أهم الاهتمامات البحثية بين المجتمع العلمي نظرًا لحقيقة أن هذه توفر العديد من المزايا ، مثل نسبة السطح إلى الحجم الكبيرة ونشاط التفاعل السطحي العالي والتواصل الإلكتروني السريع. بعد ذلك ، تبين أن المستشعر الكهروكيميائي المصمم حولهم له حد منخفض للكشف ويسمح باكتشاف المادة التحليلية من الأحجام الصغيرة [15]. علاوة على ذلك ، فإن اقتران الأجهزة الكهروكيميائية والمواد النانوية يوفر قدرة تعدد إرسال فريدة للقياسات المتزامنة للعلامات الحيوية المتعددة [10]. من بين هذه المواد النانوية ، توفر الهياكل النانوية لأكسيد الزنك (ZnO) منصة صلبة للتحسس الحيوي. يُظهر ZnO خصائص ممتازة لتصنيع أجهزة الاستشعار الحيوية ، مثل التوافق الحيوي الجيد ، والاستقرار الكيميائي ، وعدم السمية ، ومعدل نقل الإلكترون السريع [16]. الأهم من ذلك كله ، أن ZnO يتصرف كمحول طاقة ممتاز بسبب ارتفاع نقطة تساوي الطاقة الكهربية (IEP) ، التي تبلغ 9.5 تقريبًا ، والتي تسهل تجميد البروتينات أو البروتينات منخفضة الكهربي IEP [17]. من بين العديد من ZnO ذات البنية النانوية ، تمت دراسة أسلاك ZnO النانوية (ZnONWs) على نطاق واسع لتثبيط الجزيئات الحيوية [18]. تقدم هذه البنى النانوية بعض الخصائص الكيميائية والفيزيائية الفريدة الناتجة عن تأثير المقياس النانوي والتي توفر فرصًا جديدة لتطوير جهاز استشعار الحمض النووي الحيوي.

في الآونة الأخيرة ، تم الإبلاغ عن تقارير عن أجهزة الاستشعار الجينية الكهروكيميائية للكشف عن جينات وخلايا سرطان الثدي [19] [20]. ومع ذلك ، حتى الآن ، لم يتم الإبلاغ بعد عن مطور جهاز الاستشعار البيولوجي للحمض النووي للكشف عن جين سرطان الثدي (BRCA1) على أساس قطب كهربائي ذهبي معدل. كان الهدف الرئيسي من العمل المذكور هنا هو إثبات أن أسلاك ZnO النانوية ، التي نمت كيميائيًا على ركيزة Au ، يمكن أن توفر منصة مناسبة لتطوير جهاز استشعار الحمض النووي الكهروكيميائي للكشف عن الجين (BRCA1). علاوة على ذلك ، يمكن تطوير هذا المفهوم بشكل أكبر في شكل مصفوفة للكشف المتعدد عن جينات سرطان الثدي الأخرى مثل BRCA2 و p53 ويمكن أيضًا تطبيقه على عينات حقيقية من خلايا سرطان الثدي.

تم إجراء القياسات الكهروكيميائية في درجة حرارة الغرفة باستخدام AUTOLAB-PGSTAT 302N (Echo Chemie ، هولندا). تتألف الأنظمة الكهروكيميائية الثلاثة من: ZnONWs / Au كقطب كهربائي عامل ، وسلك بلاتيني كقطب كهربائي مساعد ، و Ag / AgCl كقطب مرجعي. تم إجراء DPV في 15 مل من محلول أسيتات 0.1 M (ABS) (الرقم الهيدروجيني 7.00) من 0.4 فولت إلى 1.16 فولت مع سعة تعديل = 0.025 فولت ، فترة زمنية (t1) = 0.5 ثانية ، وقت التعديل (t2) = 0.05 ثانية ، الخطوة المحتملة = 0.005 فولت ومعدل مسح 0.01 مقابل -1. تم تطهير محلول منظم الأسيتات بغاز النيتروجين لمدة 20 دقيقة قبل كل تجربة. يتميز سطح القطب ZnONWs / Au بالمجهر الإلكتروني الماسح للانبعاثات الميدانية (FESEM).

سداسي هيدرات نترات الزنك ، زنك (NO3)2・ 6 ح2O ، hexamethylenetetramine ، C.6ح12ن4، وخلات الزنك المجففة ، الزنك (CH3سجع)2∙ 2 ح2تم شراء O من Sigma Aldrich ، ألمانيا. تم شراء الـ 21 زوجًا من الحمض النووي المفرد الذي تقطعت بهم السبل من First BASE (IDT Inc ، الولايات المتحدة الأمريكية). تسلسلات قليل النوكليوتيد المختلفة هي كما يلي (تحتها خط هي القواعد غير المتطابقة):

فحص الحمض النووي: 5 "AAT GGA TTT ATC TGC TCT TCG 3"

الحمض النووي المستهدف: 5 "CGA AGA GCA GAT AAA TCC ATT 3"

عدم تطابق ثلاثي القواعد: 5 "CGA AGA GGA GAA AAA TCG ATT 3" 5 "CAA AGA GCA GAT AGA TCC GTT 3"

تم تحضير محاليل مخزون قليل النوكليوتيد (100 وميكرو مولار) بالماء منزوع الأيونات وتخزينها عند 4 درجات مئوية عندما لا تكون قيد الاستخدام. تم تحضير محلول خلات عازلة (ABS) بتركيز 0.1 م مع قيم أس هيدروجيني مختلفة عن طريق خلط أحجام مختلفة من حمض أسيتيك 0.1 مولار وخلات الصوديوم مع ماء منزوع الأيونات.

2.3 توليف أسلاك أكسيد الزنك النانوية (ZnONWs) على سطح قطب الذهب

تم إجراء نمو أسلاك ZnO النانوية بالطريقة الحرارية المائية. أولاً ، تم تنظيف قطب كهربائي / ركيزة من الذهب على رقاقة سيليكون تم شراؤها من Sigma Aldrich ، ستوكهولم ، السويد باستخدام الأيزوبروبانول ، وغسلها بماء منزوع الأيونات وجفف أخيرًا في درجة حرارة الغرفة. كخطوة أولى من التوليف ، تم تحضير طبقة بذرة من ثنائي أسيتات الزنك عن طريق الدوران المغلف لثلاث مرات عند 2500 دورة في الدقيقة لمدة 30 ثانية على الركيزة الذهبية. بعد الطلاء بالدوران ، تم تلدين الركيزة عند 120 درجة مئوية لمدة 10 - 20 دقيقة. تم لصق جزيئات البذور المحتوية على أقطاب كهربائية على حامل عينة تفلون ثم غمرها في محلول نمو مكون من (0.075 م) سداسي هيدرات نترات الزنك و (0.075 م) سداسي ميثيلينترامين عند 98 درجة مئوية لمدة 9 ساعات. بعد اكتمال نمو ZnO ، تم غسل الهياكل النانوية المزروعة بالماء منزوع الأيونات من أجل إزالة الجزيئات المتبقية في نهاية المطاف. أخيرًا ، تُركت الأقطاب الكهربائية ZnONWs / Au لتجف في درجة حرارة الغرفة.

2.4 تجميد مسبار ssDNA على سطح ZnONWs / Au Electrode

تم إسقاط 40 & microL يحتوي على 80 & microM من جزيئات ssDNA (مسبار) على قطب ZnONWs / Au. تركت جزيئات ssDNA لتثبيتها على قطب ZnO NWs / Au لمدة ساعتين. بعد شطف الأقطاب الكهربائية المعدة بـ ABS لمدة 5 ثوان لإزالة المجسات غير المقيدة. تم تصنيف القطب الناتج على أنه ssDNA / ZnONWs / Au.

2.5 تهجين ssDNA

تم إجراء اختبار التهجين عن طريق اكتشاف سطح المستشعر 40 و microL من محلول يحتوي على التركيز المطلوب ، و 80 & microM من ssDNA التكميلي ، وعدم تطابق ssDNA و ssDNA غير التكميلي على التوالي. تم ترك التهجين ليحدث لمدة 30 دقيقة. بعد ذلك تم شطف القطب باستخدام ABS لمدة 5 ثوان لإزالة الأهداف غير المهجنة ssDNA.

3.1. مورفولوجيا ZnONWs القطب الكهربائي المعدّل من الذهب و ssDNA المعطل على سطح القطب الكهربائي المعدّل من ZnONWs

في الشكل 1 (أ) يتم تقديم صورة نموذجية لـ ZnONWs المزروعة بطريقة مائية بنجاح على قطب كهربائي على سطح الذهب. من الواضح أن ZnONWs المزروعة بشكل عام كثيفة للغاية ومحاذاة رأسياً مع الوجوه السداسية على سطح القطب الكهربائي الذهبي. بالإضافة إلى ذلك ، تم تقدير حجم nanohexagones في المدى بين 450 و 550 نانومتر بكثافة موحدة وتوزيع مكاني. من حيث المبدأ ، يمكن ضبط قطر وطول ZnONWs المزروعة عن طريق التحكم الدقيق في معاملات عملية النمو مثل تركيز محلول البذور ، وقياس كائنات الكاشف ، ودرجة الحرارة ، ودرجة الحموضة لمحلول النمو [21] [22] . علاوة على ذلك ، تظهر صورة FESEM بعد تجميد مسبار ssDNA في الشكل 1 (ب). كما هو مبين بوضوح في هذا الشكل ، أدى تثبيت ssDNA على القطب الكهربائي المعدل ZnONWs إلى تغطية متجانسة. يمكن الاستنتاج أن هيكل ZnONWs يوفر منصة جيدة لشل حركة ssDNA.

شكل 1 . صورة FESEM لأسلاك أكسيد الزنك النانوية المزروعة (ZnONWs) على سطح قطب الذهب (A) ، و ssDNA المثبت على السطح الكهربائي المعدّل للذهب ZnONWs (B).

3.2 تشكيل تجميد المسبار ssDNA وتهجين ssDNA الهدف على القطب الكهربي المعدني للذهب ZnO NWs.

تمت دراسة تهجين مسبار ssDNA الثابت مع ssDNA التكميلي (الهدف) عن طريق قياس الجهد التفاضلي للنبض. يوضح الشكل 2 استجابات DPV التي تم الحصول عليها لأسطح الاستشعار المختلفة (المنحنيات c و e و f) وبعد التهجين بأهداف DNA مختلفة (المنحنيات a و b و d). لم يتم تسجيل أي قمم مرئية عند إجراء DPV في القطب الكهربي Au (المنحنى f) من ناحية أخرى عندما تم إجراء قياسات الفولتميتر على القطب ZnONWs / Au المعدل باستخدام ssDNA (بدءًا من القسم 2.4) ذروة أكسدة واضحة عند 0.94 فولت و a الكتف في كاليفورنيا. تم تسجيل 0.62 فولت. ربما ارتبطت هاتان القمتان بأكسدة قاعدتي Adenine و Guanine (0.94 V) لمسبار الحمض النووي. كما يمكن ملاحظته من المنحنى أ ، أدى التهجين مع الهدف التكميلي إلى ذروة أوسع على نطاق واسع في كاليفورنيا. 0.8 فولت [23] [24]. لم يتم تسجيل أي قمم عند إجراء التهجين بتسلسلات غير متطابقة (منحنيات ب و د) تؤكد خصوصية مستشعر الجينات المطور. علاوة على ذلك ، بدءًا من المنحنى c ، أثبت هذا أن وجود مسبار ssDNA أمر بالغ الأهمية لإجراء تهجين DNA مع هدفه لأننا لاحظنا عدم وجود استجابة كهروكيميائية في غيابه. أشارت النتائج المعروضة أعلاه إلى أن عملية التهجين على سطح المستشعر المطور انتقائية للغاية والتي حدثت فقط في وجود هدف مكمل تمامًا. علاوة على ذلك ، تم تسجيل استجابة كهروكيميائية مهمة عندما يتم تهجين الحمض النووي التكميلي على سطح المستشعر.

3.3 تأثير التحميل المستهدف للحمض النووي على استجابة المستشعر الحيوي للحمض النووي

يمثل الشكل 3 استجابة جهاز استشعار الحمض النووي بتركيزات مختلفة من هدف الحمض النووي ، مهجنًا لمدة 90 دقيقة. على سطح المستشعر. وقد لوحظت إشارات تهجين محددة جيدًا على مدى تركيز يتراوح من 10 إلى 100 ومايكرو إم من الحمض النووي المستهدف. عند زيادة تركيز الهدف (& gt100 & microM) ، انخفض تهجين إشارة DNA بشكل طفيف مما يشير إلى الوصول إلى تشبع السطح. وهكذا ، تم اختيار 100 & microM كتركيز مستهدف مثالي على تفاعل التهجين لـ ssDNA المعطل على سطح القطب ZnO NWs / Au. ويعزى ذلك إلى تغطية السطح الكاملة للقطب ZnONWs / Au عند هذا التركيز.

الشكل 2 . النبض التفاضلي الفولتموجرام (DPVs) التي تم الحصول عليها من تجميد 80 و microM ssDNA على سطح قطب الذهب المعدل ZnONWs بعد تعرض المجسات إلى 100 و microM مكمل أو مستهدف DNA (a) ، 3 حالات عدم تطابق أو ssDNA غير مجاني (ب) و ( د) ، بدون تجميد ssDNA (c) ، للقطب الكهربائي من الذهب العاري (e) و ZnO NWs المعدلة من القطب الكهربائي ssDNA (f). تم قياس DPVs عند مسح محتمل بين 0.4 إلى 1.16 فولت بسعة تعديل = 0.025 فولت ، وقت الفاصل (t1) = 0.5 ثانية ، وقت التعديل (t2) = 0.05 ثانية وإمكانية الخطوة = 0.005 فولت في 0.1 متر محلول أسيتات مؤقت عند الرقم الهيدروجيني 7.

3.4. اعتماد استجابة المستشعر الحيوي على الرقم الهيدروجيني

يوضح الشكل 4 تأثير الأس الهيدروجيني على استجابة المستشعر. في هذه المجموعة من التجارب ، تم تهجين الجينوسينور المحضر وفقًا للبروتوكول الموضح في القسم 2.4 لمدة 90 دقيقة. مع استجابة 80 & microM و DPV لقيم مختلفة من الأس الهيدروجيني. قدمت الاستجابة المسجلة حدًا أقصى عند الرقم الهيدروجيني 7 مما يشير إلى الرقم الهيدروجيني الأمثل للكشف عن الحمض النووي. يمكن وصف الاستجابة المتزايدة لجهاز الاستشعار البيولوجي للحمض النووي عند الرقم الهيدروجيني 7 لعملية تهجين أكثر كفاءة. في حالة أكثر حمضية ، يمكن أن يقلل تفاعل البروتونات من فوسفوديستر الحمض النووي من قابلية ذوبان جزيء الحمض النووي ، مما يقلل في النهاية من تهجين الحمض النووي. بالإضافة إلى ذلك ، في ظل وسط أكثر أساسية ، حدث انخفاض في عملية تهجين الحمض النووي ، وبالتالي كان هناك ميل لإنتاج تيار DPV أقل.

3.5 خصائص المعايرة واستقرار جهاز الاستشعار البيولوجي للحمض النووي

يوضح الشكل 5 تأثير تركيزات مختلفة من الحمض النووي التكميلي على استجابة جهاز الاستشعار الحيوي. تم الحصول على الاستجابة الخطية عندما تكون تركيزات BRCA1 في حدود 10 - 100 & microM. زادت الاستجابة الحالية خطيًا (R 2 = 0.994) بحساسية 6.36 & microA ∙ & microM −1 بينما أظهر القطب الذهب العاري حساسية أقل (1.97 & microA ∙ & microM −1). حد الكشف (LOD) لـ BRCA1 للإلكترود الذهبي المعدل ZnONWs المعتمد على المستشعر الحيوي ، المحسوب كإشارة للفراغ زائد ثلاثة أضعاف الانحراف المعياري [25] ، وجد أنه 3.32 & microM. تم الإبلاغ عن تقدير LOD يبلغ 3.79 × 10 م من قبل Li وزملاؤه [3] لتهجين الحمض النووي الخالي من الملصقات لـ BRCA1 استنادًا إلى أقطاب الجرافيت المطبوعة ذات الأنبوب النانوي الكربوني أحادية الجدار. يمكن فهم هذا أن تطبيق ZnONWs على قطب الذهب المعدّل لدينا لتهجين الحمض النووي إلى هدف BRCA1 يميل إلى إعطاء حساسية كبيرة في جهاز الاستشعار الحيوي المطوّر لدينا.

كشف قطب الذهب المعدّل ZnONWs أنه ركيزة قطبية ممتازة لتطوير جهاز استشعار حيوي DNA حساس للكشف عن جين سرطان الثدي BRCA1. أظهرت صورة FESEM أن البنية النانوية قد نمت بنجاح على سطح قطب الذهب بمتوسط ​​قطر يتراوح بين 450-550 نانومتر وبتوجيه جيد. علاوة على ذلك ، أوضحنا أن الكيمياء الكهربائية المباشرة للحمض النووي من خلال استخدام قياس DPV ، كانت مناسبة للكشف الانتقائي عن تسلسل الحمض النووي القصير المرتبط بجين BRCA1 ، عندما تم امتصاص مجسات الحمض النووي كيميائيًا على سطح ZnONWs / Au. أدى وجود تسلسل الحمض النووي التكميلي إلى ذروة أكسدة محددة جيدًا في كاليفورنيا. 0.8 V. حالة الأس الهيدروجيني المُحسَّنة لعملية جهاز الاستشعار الحيوي للحمض النووي كانت عند الرقم الهيدروجيني 7. كانت استجابة جهاز الاستشعار الحيوي للحمض النووي المطور خطية ضمن تركيزات الهدف التكميلية بين 10 - 100 و microM. بالإضافة إلى ذلك ، تم الحصول على LOD على

الشكل 3. التيار الناتج من تهجين الحمض النووي لـ 80 و microM ssDNA الثابت على قطب ZnONWs الذهبي المعدل إلى هدفه (BRCA1) بتركيزات مختلفة (10 إلى 120 & microM). تم قياس إشارة تيارات DPV عند مسح محتمل بين 0.4 إلى 1.16 فولت مع سعة تعديل = 0.025 فولت ، وقت الفاصل (t1) = 0.5 ثانية ، وقت التعديل (t2) = 0.05 ثانية وإمكانية الخطوة = 0.005 فولت في 0.1 م المحاليل العازلة خلات (الرقم الهيدروجيني 7).

الشكل 4. تأثير الأس الهيدروجيني على استجابة المستشعر الحيوي كما هو موضح بواسطة تيار التهجين مع الحمض النووي التكميلي في 0.1 M ABS. تم قياس إشارة تيارات DPV عند مسح محتمل بين 0.4 إلى 1.16 فولت مع سعة تعديل = 0.025 فولت ، وقت الفاصل (t1) = 0.5 ثانية ، وقت التعديل (t2) = 0.05 ثانية وإمكانية الخطوة = 0.005 فولت في 0.1 م المحاليل العازلة (درجة الحموضة 3-11).

الشكل 5. مخطط معايرة يعرض التغيرات في إشارات الأكسدة المقاسة في وجود تهجين DNA بين 80 و مجس microM BRCA1 ومستويات تركيز مختلفة لأهداف BRCA1. تم قياس إشارة تيارات DPV عند مسح محتمل بين 0.4 إلى 1.16 فولت مع سعة تعديل = 0.025 فولت ، وقت الفاصل (t1) = 0.5 ثانية ، وقت التعديل (ر2) = 0.05 ثانية وإمكانية الخطوة = 0.005 فولت في محلول عازلة 0.1 M (الرقم الهيدروجيني 7).

الاستجابة القريبة للطريقة المطورة والتي كانت 3.32 ميكرومتر.

نود أن نشكر وزارة التعليم العالي الماليزية على منحة ERGS (600 / RMI / st / ERGS / 5/3 / fst12 / 2011) و Universiti Teknologi MARA للدعم المالي عبر مخطط مساعد التدريس للدراسات العليا (UPTA) لنور عزيمة منصور لإجراء هذا البحث.

نور عظيمه منصور ، زينهرياتي محمد زين ، هيرول هشام حمزة ، محمد شهاب الدين أحمد نوردين ، سيتي سافورا جابار ، فاليريوبيني ، ظفر حسين ، إيبوبوتو ، (2014) الكشف عن سرطان الثدي 1 (BRCA1) الجين باستخدام مستشعر الحمض النووي الكهروكيميائي. مجلة Open Journal of Applied Biosensor,03، 9-17. دوى: 10.4236 / ojab.2014.32002


مطيافية امتصاص الأشعة فوق البنفسجية والانبعاثات

تم تسجيل أطياف امتصاص الأشعة فوق البنفسجية والانبعاثات على سلسلة Agilent Technologies Cary للامتصاص UV-vis-NIR ومقاييس الطيف الضوئي Cary eclipse florescence ، على التوالي باستخدام أنابيب كوارتز بطول مسار 10 مم. تم فحص أطياف الامتصاص من 230 إلى 800 نانومتر. تم إجراء معايرة انبعاث الإسفار في 20 ملي مولار من PBS (100 ملي مولار كلوريد الصوديوم / كلوريد الصوديوم) ، ودرجة الحموضة 7.4 باستخدام 1 & # 956M من TGP18 مع إضافة تدريجية مختلفة من GQ الملدنة مسبقًا والحمض النووي المزدوج حتى الوصول إلى التشبع. تم إصلاح الطول الموجي للإثارة لـ TGP18 عند 560 نانومتر وتم مسح الطول الموجي للانبعاث من 570 نانومتر إلى 800 نانومتر. تم ضبط الشقوق للإثارة والانبعاث عند 5 نانومتر. تم تسجيل التغييرات الطبيعية في مضان TGP18 واستخدمت لحساب ثابت التفكك (كد) القيمة بالتخطيط للتغيير في التألق (& # 8710F / & # 8710Fالأعلى) عند 640 نانومتر مقابل زيادة تركيز TGP18. تم تركيب نقاط البيانات التجريبية التي تم الحصول عليها في معادلة ربط خاصة بموقع واحد:

أين & # 8710F / & # 8710Fالأعلى = التغيير في التألق ، L = تركيز GQ و K.د = ثابت التفكك. تم إجراء تجربة مماثلة باستخدام DNA مزدوج الاتجاه ، حيث تمت معايرة 1 & # 956M TGP18 بتركيزات متزايدة من DNA مزدوج الاتجاه (0-30 & # 956M). تم حساب قيمة LOD باستخدام المعادلة LOD = K & # 215 S.ب/م، حيث K هو عامل عددي يتم اختياره وفقًا لمستوى الثقة المطلوب ، Sب الانحراف المعياري للقياسات الفارغة (ن = 3) و م حساسية منحنى المعايرة [48].


المواد والأساليب

الإجراء العام لتركيب البوليمرات 3.

إلى محلول 2-ethyl-2-oxazoline (3.97 جم ، 40 ملمول) في كلوروبنزين (10 مل) عند درجة حرارة الغرفة ، تمت إضافة ميثيل ثلاثي الطبقات بعناية (MeOTf ، 197 ميكرولتر ، 1.8 ملي مول). يسخن الخليط بعد ذلك عند 80 درجة مئوية لمدة ساعة واحدة ثم يبرد بسرعة بغمر الدورق في ثلج جاف. ثم يضاف 4 مل من محلول كربونات الصوديوم 5٪ إلى محلول البوليمر ، ويقلب الخليط لمدة 30 دقيقة. تم فصل الطبقة المائية ، واستخلاص الطبقة العضوية بمحلول 5٪ من كربونات الصوديوم. تم فصل الطبقات المائية ، ودمجها ، وتقليبها طوال الليل عند درجة حرارة الغرفة للتحلل المائي لأوكسازولينيوم كاتيون. تم تحمض الخليط المعكر باستخدام حمض الهيدروكلوريك المخفف لإعطاء محلول صافٍ من pH & lt 6 ثم استخلاصه باستخدام كلوريد الميثيلين. تم تجفيف الطبقات العضوية المجمعة بكبريتات المغنيسيوم اللامائية ثم تركيزها. تم ترسيب مادة صلبة بيضاء عن طريق إضافة قطرة من ثنائي إيثيل إيثر إلى المحلول المركز ، وتم جمع المادة الصلبة بالترشيح وتجفيفها طوال الليل في فرن مفرغ من الهواء لتوفير البوليمر المطلوب 1 (ن ≈ 23) (3.1 جم ، ينتج 78٪). 1 H NMR (400 ميجا هرتز ، قرص مضغوط3OD) δ 3.51–3.70 (م ، 4 ساعات ، N-CH2-CH2-) ، 2.96-3.10 (م ، 0.127 هـ ، هـ3C-N) ، 2.36-2.47 (م ، 2H ، C (O) -CH2-CH3) ، 1.10 - 1.11 (م ، 3 ساعات ، -CH2-CH3). لتعليق بولي إيثيلين أمين خطي مشتق من بلمرة أوكسازولين (1، 1 غرام ن تمت إضافة ≈ 23) في 10 مل من الماء 15 مل من حمض الهيدروكلوريك المركز (35٪). تم تسخين خليط التفاعل عند 100 درجة مئوية لمدة 48 ساعة لإزالة مجموعات البروبيونيل. تمت إزالة فائض كلوريد الهيدروجين تحت ضغط مخفض وتم إذابة المادة الصلبة البيضاء المتبقية في 10 مل من الماء. تم جعل الخليط الناتج قلويًا عن طريق إضافة هيدروكسيد الصوديوم المائي ، وتم ترشيح المادة المترسبة البيضاء المتكونة وغسلها بالماء للحصول على منتج البولي إيثيلين الخطي المطلوب. 2 (230 مجم ، العائد 53٪). 1 H NMR (400 ميجا هرتز ، قرص مضغوط3OD) δ 2.77 (ثانية ، 4 ساعات ، NH-CH2-CH2-). لتعليق البوليمر 2 (200 مجم ، 4.65 ملي مول ، ن تمت إضافة 23) في 10 مل من الماء منزوع الأيونات 4 (5) - (هيدروكسي ميثيل) إيميدازول (1.04 جم ، 10.6 ملي مول) وكربونات البوتاسيوم (4.4 جم ، 31.9 ملي مول). يسخن خليط التفاعل عند 100 درجة مئوية لمدة 24 ساعة ثم يبرد إلى درجة حرارة الغرفة. تم وضع المتبقي في أنبوب غسيل الكلى وغسيله مقابل المذيبات التالية (كل 12 إلى 24 ساعة تقريبًا): 50٪ ميثانول في الماء ، و 25٪ ميثانول في ماء ، وماء. تم تبخير المتبقي النهائي وتجفيفه للحصول على المنتج المطلوب 3 كمادة صلبة بنية مائية (281 مجم ، تنتج 49٪) (نسبة التطعيم: & gt 95٪ من وحدات إيثيلينيمين ، وفقًا لتكامل 1 H). 1 H NMR (400 ميجا هرتز ، قرص مضغوط3OD) δ 7.60–7.61 (م ، 1 ساعة ، إيميدازول) ، 6.69-6.96 (م ، ح 1 ، إيميدازول) ، 3.91 (م ، ح 1 ، N-CH2-C) ، 3.60 (م ، ح 1 ، N-CH2-C) ، 2.60–2.67 (م ، 4 ساعات ، NH-CH2-CH2-). وصف مفصل للمواد والطرق والإجراءات التركيبية وأطياف التوصيف نص SI.

معايرة القاعدة الحمضية.

قدرات التخزين المؤقت للبوليمرات 2 و 3 تم تحديدها عن طريق معايرة الحمض القاعدي. ثم 0.25 ملي مول من 2 أو 3 (تركيز وحدات الإيثيلين أمين) إلى 6 مل من الماء منزوع الأيونات ، ثم تمت إضافة 5 مل من 0.1 N HCl إلى المعلق من أجل الحصول على محلول واضح وضبط الرقم الهيدروجيني إلى كاليفورنيا. 2. ثم تمت إضافة 200 جزء ميكرولتر من 0.05 مولار هيدروكسيد الصوديوم بالتسلسل إلى المحلول ، وتم قياس الأس الهيدروجيني بعد كل إضافة باستخدام مقياس الأس الهيدروجيني UltraBASIC Benchtop (UB-5) باستخدام قطب كهربي للأس الهيدروجيني لهيكل زجاجي UltraBasic.

تحديد فعل ملزم.

تم تسجيل أطياف الأشعة فوق البنفسجية عند درجة حرارة الغرفة ، بالنسبة إلى بولي (U) (180 نانومول في U) والبوليمر 3 (ن ≈ 23) مذاب في 5 مل من محلول فوسفات 10 ملي مولار (Na2HPO4-NaH2ص4) عند pH 7.55. تم تسجيل أطياف القرص المضغوط في درجة حرارة الغرفة ، بالنسبة إلى بولي (U) (375 نانومول في U) والبوليمر 3 (ن ≈ 23) مذاب مباشرة في 5 مل من محلول فوسفات 10 ملي مولار (Na2HPO4-NaH2ص4) عند درجة الحموضة 7.5.

المقايسة الحركية الأنزيمية.

يشير المخزن المؤقت A إلى الرقم الهيدروجيني 7.00 (25 درجة مئوية) ، 0.125 M Trizma® [tris- (hydroxymethyl) -aminomethane] قاعدة / حمض السكسينيك ، 0.125 M NaCl ، 18.8 ملي MgCl2. صُنعت مخازن تفاعل الانقسام بواسطة Trizma® base / Trizma® hydrochloride. تم تعديل القوة الأيونية إلى 0.1 مولار مع كلوريد الصوديوم. تم قياس الأس الهيدروجيني لمحلول التفاعل قبل التفاعل عند 25 درجة مئوية واستقراء إلى 80 درجة مئوية ، درجة حرارة التفاعل ، بمساعدة اعتماد درجة الحرارة المعروف. تم تجميد جميع المخازن المؤقتة قبل الاستخدام. تم تحضير حلول التفاعل من خلال الجمع بين كمية مناسبة من بولي (U) ، ص-ملح الصوديوم بحمض النيتروبنزين سلفونيك كمعيار داخلي ، محفزات بوليمر ، ومحلول منظم لإعطاء خليط تفاعل (بالنسبة لبولي فينليميدازول ، تم استخدام 30 ٪ من الإيثانول في محلول Trizma-HCl كمنظم). على فترات مناسبة ، تمت إزالة العينات من خليط التفاعل ، وتبريدها إلى درجة حرارة الغرفة ، ومعالجتها على الفور بمحلول سم فوسفوديستراز I (حوالي 25 وحدة · مل -1 في المخزن المؤقت أ). تم تغطية الأنبوب ، وخلطه بقوة ، وغمره في سخان كتلة معادل حراريًا عند 40 درجة مئوية. بعد الحضانة لمدة 6 ساعات ، تمت إزالة العينات ووضعها في ثلج جاف حتى تصبح جاهزة للتحليل بواسطة HPLC. تم حساب تركيزات اليوريدين في عينات التفاعل من المعادلة التي تم الحصول عليها مسبقًا باستخدام التركيز الأولي للمعيار. ثابت معدل الدرجة الزائفة من الدرجة الأولى كObs تم الحصول على الانقسام من قسمة منحدر قطعة أرض [Uridine] مقابل الوقت بالتركيز الأولي للبولي (U). إجراء تمثيلي ، معالجة عينة الانقسام أطياف HPLC ، والنتائج موصوفة في نص SI.


شاهد الفيديو: الرقم الهيدروجيني PH الجزء 2 (كانون الثاني 2022).